ISSN 1977-0820

Europeiska unionens

officiella tidning

L 328

European flag  

Svensk utgåva

Lagstiftning

60 årgången
12 december 2017


Innehållsförteckning

 

II   Icke-lagstiftningsakter

Sida

 

 

FÖRORDNINGAR

 

*

Kommissionens delegerade förordning (EU) 2017/2278 av den 4 september 2017 om ändring av bilaga I till rådets förordning (EG) nr 1217/2009 om upprättandet av ett informationssystem för jordbruksföretagens redovisningsuppgifter för att belysa inkomstförhållanden och andra ekonomiska förhållanden i jordbruksföretag inom Europeiska unionen

1

 

*

Kommissionens förordning (EU) 2017/2279 av den 11 december 2017 om ändring av bilagorna II, IV, VI, VII och VIII till Europaparlamentets och rådets förordning (EG) nr 767/2009 om utsläppande på marknaden och användning av foder ( 1 )

3

 

*

Kommissionens genomförandeförordning (EU) 2017/2280 av den 11 december 2017 om ändring av genomförandeförordning (EU) 2015/220 om tillämpningsföreskrifter för rådets förordning (EG) nr 1217/2009 om upprättandet av ett informationssystem för jordbruksföretagens redovisningsuppgifter för att belysa inkomstförhållanden och andra ekonomiska förhållanden i jordbruksföretag inom Europeiska unionen

12

 

*

Kommissionens genomförandeförordning (EU) 2017/2281 av den 11 december 2017 om godkännande av en höjning av gränsvärdena för berikning av vin som produceras av druvor som skördats under 2017 i vissa vinodlingsområden i Tyskland och i alla vinodlingsområden i Danmark, Nederländerna och Sverige

17

 

 

BESLUT

 

*

Rådets beslut (Gusp) 2017/2282 av den 11 december 2017 om ändring av beslut 2010/788/Gusp om restriktiva åtgärder mot Demokratiska republiken Kongo

19

 

*

Rådets beslut (Gusp) 2017/2283 av den 11 december 2017 till stöd för en global rapporteringsmekanism för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition avsedd att minska risken för olaglig handel med dessa (iTrace III)

20

 

*

Rådets beslut (EU) 2017/2284 av den 11 december 2017 om tillhandahållande av stöd till stater i Afrika, Asien-Stillahavsområdet samt Latinamerika och Västindien för att delta i en samrådsprocess i den förberedande expertgruppen på hög nivå för ett fördrag om förbud mot framställning av klyvbart material för kärnvapen

32

 

*

Kommissionens beslut (EU) 2017/2285 av den 6 december 2017 om ändring av användarhandledningen om hur man ska gå till väga för att delta i Emas i enlighet med Europaparlamentets och rådets förordning (EG) nr 1221/2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning (Emas) [delgivet med nr C(2017) 8072]  ( 1 )

38

 

*

Kommissionens genomförandebeslut (EU) 2017/2286 av den 6 december 2017 om erkännande av att kraven för miljöledningssystemet Eco-Lighthouse uppfyller motsvarande krav i miljölednings- och miljörevisionsordningen (Emas) i enlighet med artikel 45 i Europaparlamentets och rådets förordning (EG) nr 1221/2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning [delgivet med nr C(2017) 8082]  ( 1 )

87

 

*

Kommissionens genomförandebeslut (EU) 2017/2287 av den 8 december 2017 om angivande av de formulär som ska användas vid import av kvicksilver och vissa kvicksilverblandningar i enlighet med Europaparlamentets och rådets förordning (EU) 2017/852 om kvicksilver [delgivet med nr C(2017) 8190]  ( 1 )

118

 

*

Kommissionens genomförandebeslut (EU) 2017/2288 av den 11 december 2017 om fastställande av tekniska specifikationer för informations- och kommunikationsteknik som hänvisning vid offentlig upphandling ( 1 )

123

 

*

Kommissionens genomförandebeslut (EU) 2017/2289 av den 11 december 2017 om ändring av bilagan till genomförandebeslut (EU) 2017/247 om skyddsåtgärder i samband med utbrott av högpatogen aviär influensa i vissa medlemsstater [delgivet med nr C(2017) 8631]  ( 1 )

126

 

 

AKTER SOM ANTAS AV ORGAN SOM INRÄTTATS GENOM INTERNATIONELLA AVTAL

 

*

Beslut nr 52/2017 av den Gemensamma kommitté som inrättats enligt avtalet om ömsesidigt erkännande mellan Europeiska gemenskapen och Amerikas förenta stater av den 24 november 2017 beträffande listning av organ för bedömning av överensstämmelse i den sektoriella bilagan om elektromagnetisk kompatibilitet [2017/2290]

136

 

*

Beslut nr 53/2017 av den Gemensamma kommitté som inrättats enligt avtalet om ömsesidigt erkännande mellan Europeiska gemenskapen och Amerikas förenta stater av den 24 november 2017 beträffande listning av organ för bedömning av överensstämmelse i den sektoriella bilagan om elektromagnetisk kompatibilitet [2017/2291]

138

 

*

Beslut nr 54/2017 av den Gemensamma kommitté som inrättats enligt avtalet om ömsesidigt erkännande mellan Europeiska gemenskapen och Amerikas förenta stater av den 24 november 2017 beträffande listning av organ för bedömning av överensstämmelse i den sektoriella bilagan om elektromagnetisk kompatibilitet [2017/2292]

140

 


 

(1)   Text av betydelse för EES.

SV

De rättsakter vilkas titlar är tryckta med fin stil är sådana rättsakter som har avseende på den löpande handläggningen av jordbrukspolitiska frågor. De har normalt en begränsad giltighetstid.

Beträffande alla övriga rättsakter gäller att titlarna är tryckta med fetstil och föregås av en asterisk.


II Icke-lagstiftningsakter

FÖRORDNINGAR

12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/1


KOMMISSIONENS DELEGERADE FÖRORDNING (EU) 2017/2278

av den 4 september 2017

om ändring av bilaga I till rådets förordning (EG) nr 1217/2009 om upprättandet av ett informationssystem för jordbruksföretagens redovisningsuppgifter för att belysa inkomstförhållanden och andra ekonomiska förhållanden i jordbruksföretag inom Europeiska unionen

EUROPEISKA KOMMISSIONEN HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om Europeiska unionens funktionssätt,

med beaktande av rådets förordning (EG) nr 1217/2009 av den 30 november 2009 om upprättandet av ett informationssystem för jordbruksföretagens redovisningsuppgifter för att belysa inkomstförhållanden och andra ekonomiska förhållanden i jordbruksföretag inom Europeiska unionen (1), särskilt artikel 3, och

av följande skäl:

(1)

Bilaga I till förordning (EG) nr 1217/2009 innehåller en förteckning över områdena i informationssystemet för jordbruksföretagens redovisningsuppgifter (nedan kallade ISJR-områden) per medlemsstat.

(2)

Enligt den bilagan är Tyskland uppdelat i 16 områden. För tillämpningen av förordning (EG) nr 1217/2009 har Tyskland begärt att ISJR-områdena Schleswig-Holstein och Hamburg ska slås samman till ett ISJR-område, nämligen Schleswig-Holstein/Hamburg.

(3)

Förordning (EG) nr 1217/2009 bör därför ändras i enlighet med detta.

(4)

Den uppdaterade förteckning över ISJR-områden som fastställs i denna förordning bör tillämpas från och med räkenskapsåret 2018.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

Bilaga I till förordning (EG) nr 1217/2009 ska ändras i enlighet med bilagan till den här förordningen.

Artikel 2

Denna förordning träder i kraft den sjunde dagen efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Den ska tillämpas från och med räkenskapsåret 2018.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Bryssel den 4 september 2017.

På kommissionens vägnar

Jean-Claude JUNCKER

Ordförande


(1)  EUT L 328, 15.12.2009, s. 27.


BILAGA

I bilaga I till förordning (EG) nr 1217/2009 ska förteckningen över de ISJR-områden som gäller Tyskland ersättas med följande:

”Tyskland

1.

Schleswig-Holstein/Hamburg

2.

Niedersachsen

3.

Bremen

4.

Nordrhein-Westfalen

5.

Hessen

6.

Rheinland-Pfalz

7.

Baden-Württemberg

8.

Bayern

9.

Saarland

10.

Berlin

11.

Brandenburg

12.

Mecklenburg-Vorpommern

13.

Sachsen

14.

Sachsen-Anhalt

15.

Thüringen”


12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/3


KOMMISSIONENS FÖRORDNING (EU) 2017/2279

av den 11 december 2017

om ändring av bilagorna II, IV, VI, VII och VIII till Europaparlamentets och rådets förordning (EG) nr 767/2009 om utsläppande på marknaden och användning av foder

(Text av betydelse för EES)

EUROPEISKA KOMMISSIONEN HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om Europeiska unionens funktionssätt,

med beaktande av Europaparlamentets och rådets förordning (EG) nr 767/2009 av den 13 juli 2009 om utsläppande på marknaden och användning av foder, om ändring av Europaparlamentets och rådets förordning (EG) nr 1831/2003 och om upphävande av rådets direktiv 79/373/EEG, kommissionens direktiv 80/511/EEG, rådets direktiv 82/471/EEG, 83/228/EEG, 93/74/EEG, 93/113/EG och 96/25/EG samt kommissionens beslut 2004/217/EG (1), särskilt artiklarna 20.2 och 27.1, och

av följande skäl:

(1)

För att möjliggöra en meningsfull märkning är särskilda uttryck för sällskapsdjursfoder tillåtna på vissa unionsspråk. Ny utveckling inom sällskapsdjurssektorn i två medlemsstater tyder på att särskilda uttryck för sällskapsdjursfoder också är nödvändiga i språket i dessa medlemsstater.

(2)

Bilaga II till förordning (EG) nr 767/2009 bör därför ändras i enlighet med detta.

(3)

Toleranserna för analytiska beståndsdelar och fodertillsatser i foderråvaror och foderblandningar bör ses över mot bakgrund av framstegen med den tekniska analysen och erfarenheterna med god laboratoriesed. Bilaga IV till förordning (EG) nr 767/2009 bör därför ändras i enlighet med detta.

(4)

I allt fler godkännanden av fodertillsatser i enlighet med Europaparlamentets och rådets förordning (EG) nr 1831/2003 (2) fastställs det högsta halter för tillsatser i foderblandningar och foderråvaror, för vilka inga sådana värden tidigare fastställts, och i andra godkännanden har begreppet rekommenderad högsta halt av en tillsats i helfoder nyligen införts. Dessutom kan produktionstekniken för foder leda till en minskning av den tillsatta mängden tillsatser, såsom vitaminer, vilka också kan ingå naturligt i slutprodukten. Detta kan leda till oklarheter i praktiken, om företagaren ska ange den tillsatta mängden medan kontrollmyndigheten endast kan analysera och kontrollera mängden i slutprodukten. I syfte att ta hänsyn till denna utveckling och säkerställa en balanserad, ändamålsenlig och meningsfull märkning av foderråvaror och foderblandningar bör bilagorna VI och VII till förordning (EG) nr 767/2009 ändras i enlighet med detta.

(5)

Till följd av den tekniska utvecklingen kan allt mer livsmedel som inte längre är avsedda som livsmedel användas som foder. I kommissionens förordning (EU) nr 68/2013 (3) förtecknas dessa ”före detta livsmedel” som foderråvaror. Eftersom kvaliteten på dessa före detta livsmedel i vissa fall inte överensstämmer med kraven för foder bör märkningen av dem dock ange att de endast får användas som foder efter bearbetning. Bilaga VIII till förordning (EG) nr 767/2009 bör därför ändras i enlighet med detta.

(6)

Eftersom det inte finns några säkerhetskäl som påkallar att ändringarna till bilagorna tillämpas omedelbart är det ändamålsenligt att införa övergångsbestämmelser för att möjliggöra en smidig övergång avseende märkningen så att onödiga avbrott i verksamheten undviks och ingen onödig administrativ börda införs för företagarna.

(7)

De åtgärder som föreskrivs i denna förordning är förenliga med yttrandet från ständiga kommittén för växter, djur, livsmedel och foder.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

Bilagorna II, IV, VI, VII och VIII till förordning (EG) nr 767/2009 ska ändras i enlighet med bilagan till den här förordningen.

Artikel 2

1.   Foderråvaror och foderblandningar som har märkts före den 1 januari 2019 i enlighet med de bestämmelser som tillämpades före den 1 januari 2018 får fortsätta att släppas ut på marknaden och användas till dess att lagren har tömts om de är avsedda för livsmedelsproducerande djur.

2.   Foderråvaror och foderblandningar som har märkts före den 1 januari 2020 i enlighet med de bestämmelser som tillämpades före den 1 januari 2018 får fortsätta att släppas ut på marknaden och användas till dess att lagren har tömts om de är avsedda för icke-livsmedelsproducerande djur.

Artikel 3

Denna förordning träder i kraft den tjugonde dagen efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Bryssel den 11 december 2017.

På kommissionens vägnar

Jean-Claude JUNCKER

Ordförande


(1)  EUT L 229, 1.9.2009, s. 1.

(2)  Europaparlamentets och rådets förordning (EG) nr 1831/2003 av den 22 september 2003 om fodertillsatser (EUT L 268, 18.10.2003, s. 29).

(3)  Kommissionens förordning (EU) nr 68/2013 av den 16 januari 2013 om en förteckning över foderråvaror (EUT L 29, 30.1.2013, s. 1).


BILAGA

1.

Bilaga II ska ändras på följande sätt:

Punkt 3 b ska ersättas med följande:

”b)

För sällskapsdjursfoder ska följande uttryck vara tillåtna: På bulgariska ”храна”, på spanska ”alimento”, på tjeckiska kan beteckningen ”kompletní krmná směs” ersättas med ”kompletní krmivo” och ”doplňková krmná směs” kan ersättas med ”doplňkové krmivo”, på engelska ”pet food”, på italienska ”alimento”, på ungerska ”állateledel”, på nederländska ”samengesteld voeder”, på polska ”karma”, på slovenska ”hrana za hišne živali”, på finska ”lemmikkieläinten ruoka”, på estniska ”lemmikloomatoit”, på kroatiska ”hrana za kućne ljubimce”.”

2.

Bilaga IV ska ändras på följande sätt:

Del A ska ersättas med följande:

”Del A: Toleranser för analytiska beståndsdelar som anges i bilagorna I, V, VI och VII

1.

De toleranser som fastställs i denna del omfattar tekniska och analytiska avvikelser. När analytiska toleranser som omfattar mätosäkerheter och procedurvariationer fastställts på unionsnivå bör de värden som fastställs i punkt 2 anpassas så att endast de tekniska toleranserna omfattas.

2.

Om sammansättningen av en foderråvara eller foderblandning visar sig avvika från det angivna värdet för de analytiska beståndsdelar som anges i bilagorna I, V, VI och VII ska följande toleranser gälla:

Beståndsdel

Deklarerad halt för beståndsdelen

Tolerans (1)

 

(%)

Under det angivna värdet

Över det angivna värdet

råfett

< 8

1

2

8 – 24

12,5 %

25 %

> 24

3

6

råfett, foder för icke livsmedelsproducerande djur

< 16

2

4

16 – 24

12,5 %

25 %

> 24

3

6

råprotein

< 8

1

1

8 – 24

12,5 %

12,5 %

> 24

3

3

råprotein, foder för icke livsmedelsproducerande djur

< 16

2

2

16 – 24

12,5 %

12,5 %

> 24

3

3

råaska

< 8

2

1

8 – 32

25 %

12,5 %

> 32

8

4

växttråd

< 10

1,75

1,75

10–20

17,5 %

17,5 %

> 20

3,5

3,5

socker

< 10

1,75

3,5

10 – 20

17,5 %

35 %

> 20

3,5

7

stärkelse

< 10

3,5

3,5

10 – 20

35 %

35 %

> 20

7

7

kalcium

< 1

0,3

0,6

1 – 5

30 %

60 %

> 5

1,5

3

magnesium

< 1

0,3

0,6

1 – 5

30 %

60 %

> 5

1,5

3

natrium

< 1

0,3

0,6

1 – 5

30 %

60 %

> 5

1,5

3

total fosfor

< 1

0,3

0,3

1 – 5

30 %

30 %

> 5

1,5

1,5

aska som inte kan lösas i saltsyra

< 1

inga fastställda begränsningar

0,3

1 – < 5

30 %

> 5

1,5

kalium

< 1

0,2

0,4

1 – 5

20 %

40 %

> 5

1

2

vatten

< 2

inga fastställda begränsningar

0,4

2 – < 5

20 %

5 – 12,5

1

> 12,5

8 %

Energivärde (2)

 

5 %

10 %

Proteinvärde (2)

 

10 %

20 %

3.

Bilaga VI ska ersättas med följande:

BILAGA VI

Märkningsuppgifter för foderråvaror och foderblandningar för livsmedelsproducerande djur

Kapitel I: Obligatorisk och frivillig märkning av fodertillsatser som det hänvisas till i artiklarna 15 f och 22.1

1.

Följande fodertillsatser ska förtecknas med specifikt namn, identifieringsnummer, tillsatt mängd och namn på funktionell grupp i enlighet med bilaga I till förordning (EG) nr 1831/2003 alternativt den kategori som avses i artikel 6.1 i den förordningen:

a)

Tillsatser för vilka högsta tillåten halt fastställts för minst ett livsmedelsproducerande djur.

b)

Tillsatser som hör till någon av kategorierna ”zootekniska tillsatser” eller ”koccidiostatika eller histomonostatika”.

c)

Tillsatser för vilka de rekommenderade högsta halterna som fastställts i den rättsakt som godkänner fodertillsatsen överskrids.

Märkningsuppgifterna ska anges i enlighet med den rättsakt som godkänner fodertillsatsen i fråga.

Den tillsatta mängd som avses i första stycket ska uttryckas som mängden fodertillsats förutom när det i den rättsakt som godkänner fodertillsatsen anges ett ämne i kolumnen för lägsta/högsta halt. I det senare fallet ska den tillsatta mängden uttryckas som mängd av det ämnet.

2.

När det gäller fodertillsatser i den funktionella gruppen vitaminer, provitaminer och kemiskt väldefinierade ämnen med likartad effekt som måste förtecknas i enlighet med punkt 1 får den totala mängd som garanteras under hela hållbarhetstiden anges vid märkningen under rubriken ”Analytiska beståndsdelar” i stället för den tillsatta mängden under rubriken ”Tillsatser”.

3.

Namnet på den funktionella grupp som avses i punkterna 1, 4 och 6 får ersättas av följande förkortning, om det inte fastställts någon förkortning i bilaga I till förordning (EG) nr 1831/2003:

Funktionell grupp

Namn och beskrivning

Förkortat namn

1h

Ämnen för kontroll av kontamination av radionuklider: ämnen som förhindrar upptagandet av radionuklider eller främjar utsöndring av sådana.

Radionuklidreglerare

1m

Ämnen avsedda att minska mykotoxinkontaminationen i foder: ämnen som kan hindra eller minska absorptionen av mykotoxiner, främja utsöndringen av mykotoxiner eller ändra deras verkningssätt.

Mykotoxinminskare

1n

Hygienkvalitetsförbättrande medel: ämnen eller, i tillämpliga fall, mikroorganismer som har en positiv inverkan på fodrets hygieniska kvalitet genom reducering av en specifik mikrobiologisk kontaminant.

Hygienförbättrare

2b

Aromämnen: ämnen som när de tillsätts fodret förhöjer dess doft eller aptitlighet.

Aromer

3a

Vitaminer, provitaminer och kemiskt väldefinierade ämnen med likartad effekt

Vitaminer

3b

Föreningar av spårelement

Spårelement

3c

Aminosyror, deras salter och analoger

Aminosyror

3d

Urinämne och derivat därav

Urea

4c

Ämnen med positiv inverkan på miljön

Miljöförbättrare

4.

Fodertillsatser som framhävs i märkningen genom ord, bild eller grafik ska i tillämpliga fall anges i enlighet med punkterna 1 eller 2.

5.

Den person som ansvarar för märkningen ska på köparens begäran ange namnet på samt identifieringsnummer och funktionell grupp för fodertillsatser som ingår men som inte nämns i punkterna 1, 2 och 4. Denna bestämmelse ska inte tillämpas på aromämnen.

6.

Fodertillsatser som inte nämns i punkterna 1, 2 och 4 får anges frivilligt, åtminstone med deras namn, eller när det gäller aromämnen, åtminstone med deras funktionella grupp.

7.

Utan att det påverkar tillämpningen av punkt 6, ska, om en organoleptisk tillsats eller näringstillsats frivilligt anges i märkningen, i tillämpliga fall den mängd som tillsatts anges i enlighet med punkt 1 eller 2.

8.

Om en tillsats tillhör fler än en funktionell grupp ska den funktionella grupp eller kategori som motsvarar dess huvudsakliga funktion i fodret i fråga anges.

9.

Märkningsuppgifter om korrekt användning av foderråvaror och foderblandningar som fastställts i den rättsakt som godkänner fodertillsatsen ska anges.

Kapitel II: Märkning av analytiska beståndsdelar i enlighet med artiklarna 17.1 f och 22.1

1.

De analytiska beståndsdelarna av foderblandningar för livsmedelsproducerande djur ska anges på etiketten med rubriken ”Analytiska beståndsdelar” (3) på följande sätt:

Foderblandningar

Målarter

Analytiska beståndsdelar och nivåer

Helfoder

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Svin och fjäderfä

Svin och fjäderfä

Råprotein

Växttråd

Råfett

Råaska

Kalcium

Natrium

Fosfor

Lysin

Metionin

Kompletteringsfoder – mineral

Samtliga arter

Samtliga arter

Samtliga arter

Svin och fjäderfä

Svin och fjäderfä

Idisslare

Kalcium

Natrium

Fosfor

Lysin

Metionin

Magnesium

Kompletteringsfoder – övriga

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Samtliga arter

Svin och fjäderfä

Svin och fjäderfä

Idisslare

Råprotein

Växttråd

Råfett

Råaska

Kalcium ≥ 5 %

Natrium

Fosfor ≥ 2 %

Lysin

Metionin

Magnesium ≥ 0,5 %

2.

Den totala mängden ska anges för ämnen under denna rubrik som också är organoleptiska tillsatser eller näringstillsatser.

3.

Om energivärdet och/eller proteinvärdet anges ska det ske i enlighet med artikel 11 i förordning (EG) nr 882/2004.

4.

Bilaga VII ska ersättas med följande:

BILAGA VII

Märkningsuppgifter för foderråvaror och foderblandningar för icke livsmedelsproducerande djur

Kapitel I: Obligatorisk och frivillig märkning av fodertillsatser som det hänvisas till i artiklarna 15 f och 22.1

1.

Följande fodertillsatser ska förtecknas med specifikt namn och/eller identifieringsnummer, tillsatt mängd och namn på funktionell grupp i enlighet med bilaga I till förordning (EG) nr 1831/2003 alternativt den kategori som avses i artikel 6.1 i den förordningen:

a)

Tillsatser för vilka högsta tillåten halt fastställts för minst ett icke livsmedelsproducerande djur.

b)

Tillsatser som hör till någon av kategorierna ”zootekniska tillsatser” eller ”koccidiostatika eller histomonostatika”.

c)

Tillsatser för vilka de rekommenderade högsta halterna som fastställts i den rättsakt som godkänner fodertillsatsen överskrids.

Märkningsuppgifterna ska anges i enlighet med den rättsakt som godkänner fodertillsatsen i fråga.

Den tillsatta mängd som avses i första stycket ska uttryckas som mängden fodertillsats förutom när det i den rättsakt som godkänner fodertillsatsen anges ett ämne i kolumnen för lägsta/högsta halt. I det senare fallet ska den tillsatta mängden uttryckas som mängd av det ämnet.

2.

När det gäller fodertillsatser i den funktionella gruppen vitaminer, provitaminer och kemiskt väldefinierade ämnen med likartad effekt som måste förtecknas i enlighet med punkt 1 får den totala mängd som garanteras under hela hållbarhetstiden anges vid märkningen under rubriken ”Analytiska beståndsdelar” i stället för den tillsatta mängden under rubriken ”Tillsatser”.

3.

Namnet på den funktionella grupp som avses i punkterna 1, 5 och 7 får ersättas av förkortningen i enlighet med tabellen i punkt 3 i bilaga VI, om förkortningen inte fastställts i bilaga I till förordning (EG) nr 1831/2003.

4.

Fodertillsatser som framhävs i märkningen genom ord, bild eller grafik ska i tillämpliga fall anges i enlighet med punkterna 1 eller 2.

5.

Genom undantag från punkt 1 måste endast de aktuella funktionella grupperna anges för tillsatser i de funktionella grupperna ”konserveringsmedel”, ”antioxidanter”, ”färgämnen” och ”aromämnen”. I detta fall ska de uppgifter som avses i punkt 1 och 2 på köparens begäran lämnas av den person som ansvarar för märkningen.

6.

Den person som ansvarar för märkningen ska på köparens begäran ange namnet på samt identifieringsnummer och funktionell grupp för fodertillsatser som ingår men som inte nämns i punkterna 1, 2 och 4. Denna bestämmelse ska inte tillämpas på aromämnen.

7.

Fodertillsatser som inte nämns i punkterna 1, 2 och 4 får anges frivilligt, åtminstone med deras namn, eller när det gäller aromämnen, åtminstone med deras funktionella grupp.

8.

Den tillsatta mängden av en organoleptisk tillsats eller näringstillsats ska anges i enlighet med punkt 1 eller 2, i tillämpliga fall, om märkningen är frivillig.

9.

Om en tillsats tillhör fler än en funktionell grupp ska den funktionella grupp eller kategori som motsvarar dess huvudsakliga funktion i fodret i fråga anges.

10.

Märkningsuppgifter om korrekt användning av foderråvaror och foderblandningar som fastställts i den rättsakt som godkänner fodertillsatsen ska anges.

Kapitel II: Märkning av analytiska beståndsdelar i enlighet med artiklarna 17.1 f och 22.1

1.

De analytiska beståndsdelarna av foderblandningar för icke livsmedelsproducerande djur ska förtecknas under rubriken ”Analytiska beståndsdelar” (4) och ska märkas på följande sätt:

Foderblandningar

Målarter

Analytiska beståndsdelar

Helfoder

Katter, hundar och pälsdjur

Katter, hundar och pälsdjur

Katter, hundar och pälsdjur

Katter, hundar och pälsdjur

Råprotein

Växttråd

Råfett

Råaska

Kompletteringsfoder – mineral

Samtliga arter

Samtliga arter

Samtliga arter

Kalcium

Natrium

Fosfor

Kompletteringsfoder – övriga

Katter, hundar och pälsdjur

Katter, hundar och pälsdjur

Katter, hundar och pälsdjur

Katter, hundar och pälsdjur

Råprotein

Växttråd

Råfett

Råaska

2.

Den totala mängden ska anges för ämnen under denna rubrik som också är organoleptiska tillsatser eller näringstillsatser.

3.

Om energivärdet och/eller proteinvärdet anges ska det ske i enlighet med artikel 11 i förordning (EG) nr 882/2004.

5.

Bilaga VIII ska ändras på följande sätt:

a)

Punkt 1 ska ersättas med följande:

”1.

Förorenade varor ska märkas med ”foder med alltför höga nivåer av … (beteckning av det främmande ämnet i enlighet med bilaga I till direktiv 2002/32/EG), får endast användas som foder efter avgiftning i godkända anläggningar”. Godkännande av sådana anläggningar ska ske i enlighet med artikel 10.2 eller 10.3 i förordning (EG) nr 183/2005.”

b)

Följande punkt ska läggas till:

”3.

Utan att det påverkar tillämpningen av punkterna 1 och 2 ska före detta livsmedel som måste bearbetas innan de kan användas som foder märkas på följande sätt: ”tidigare livsmedel, får endast användas som foder efter ... (utseende av lämplig bearbetningsmetod i enlighet med del B i bilagan till förordning (EU) nr 68/2013)”.”


(1)  Toleranserna ska antingen anges som ett absolut procentvärde (detta värde måste dras av/läggas till den deklarerade halten) eller som ett relativt värde markerat med ”%” efter värdet (denna procent måste tillämpas på den deklarerade halten för att beräkna den godtagbara avvikelsen).

(2)  Toleranserna ska tillämpas där ingen tolerans har fastställts i enlighet med någon EU-metod eller officiell nationell metod i den medlemsstat där fodret har släppts ut på marknaden eller i enlighet med en metod som Europeiska standardiseringskommittén antagit (https://standards.cen.eu/dyn/www/f?p=204:32:0::::FSP_ORG_ID,FSP_LANG_ID:6308,25&cs=1C252307F473504B6354F4EE56B99E235).”

(3)  På tyska får ”analytische Bestandteile” ersättas med ”Inhaltsstoffe”. På svenska får ”Analytiska beståndsdelar” ersättas med ”Analyserat innehåll”.

(4)  På tyska får ”analytische Bestandteile” ersättas med ”Inhaltsstoffe”. På svenska får ”Analytiska beståndsdelar” ersättas med ”Analyserat innehåll”.


12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/12


KOMMISSIONENS GENOMFÖRANDEFÖRORDNING (EU) 2017/2280

av den 11 december 2017

om ändring av genomförandeförordning (EU) 2015/220 om tillämpningsföreskrifter för rådets förordning (EG) nr 1217/2009 om upprättandet av ett informationssystem för jordbruksföretagens redovisningsuppgifter för att belysa inkomstförhållanden och andra ekonomiska förhållanden i jordbruksföretag inom Europeiska unionen

EUROPEISKA KOMMISSIONEN HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om Europeiska unionens funktionssätt,

med beaktande av rådets förordning (EG) nr 1217/2009 av den 30 november 2009 om upprättandet av ett informationssystem för jordbruksföretagens redovisningsuppgifter för att belysa inkomstförhållanden och andra ekonomiska förhållanden i jordbruksföretag inom Europeiska unionen (1), särskilt artikel 5a.2, artikel 8.3 tredje och fjärde stycket samt artikel 19.3, och

av följande skäl:

(1)

I kommissionens genomförandeförordning (EU) 2015/220 (2) fastställs antalet rapporterande företag per medlemsstat och per område i informationssystemet för jordbruksföretagens redovisningsuppgifter (ISJR). I samma genomförandeförordning fastställs att medlemsstaterna måste underrätta kommissionen om den plan som upprättas för urval av rapporterande företag som säkerställer att ett representativt räkenskapsurval erhålls för undersökningsområdet före inledningen av det räkenskapsår som planen avser.

(2)

Efter en begäran från Tyskland att få sammanslå områdena Schleswig-Holstein och Hamburg till ett enda område med namnet Schleswig-Holstein/Hamburg och begärandena från Grekland, Ungern, Rumänien och Finland att få ändra antalet rapporterande företag eller tröskelvärdet för ekonomisk storlek till följd av strukturella förändringar inom jordbruket är det lämpligt att låta dessa medlemsstater revidera sina urvalsplaner och/eller tröskelvärden för ekonomisk storlek för räkenskapsåret 2018 och omfördela eller ändra antalet rapporterande företag i enlighet med detta.

(3)

Eftersom det blir allt viktigare att redovisningsuppgifterna är tillgängliga tidigare och att de är av hög kvalitet, uppmanar kommissionen medlemsstaterna att göra ytterligare organisationsinsatser som gör det möjligt att uppdatera uppgifterna och se till att de är fullständiga samt sända in företagsredovisningarna före tidsfristerna i artikel 10 i genomförandeförordning (EU) 2015/220.

(4)

I syfte att se till att de redovisningsuppgifter som medlemsstaterna sänder in är tillgängliga tidigare, fullständiga och av allt bättre kvalitet, bör tidsfristerna för insändande av uppgifter och förfarandet för utbetalning av standardavgiften ses över och kopplas till att ISJR-uppgifterna lämnas till kommissionen i tid och att de är fullständiga.

(5)

En övergångsbestämmelse gällande tillgängliga budgetmedel under räkenskapsåret 2018 bör införas i artikel 14 i genomförandeförordning (EU) 2015/220.

(6)

I bilaga VIII till genomförandeförordning (EU) 2015/220 fastställs redovisningsuppgifternas format och utformning i företagsredovisningarna. Bilaga VIII bör för tydlighetens skull innehålla kompletterande information om hur uppgifterna ska presenteras.

(7)

Genomförandeförordning (EU) 2015/220 bör därför ändras i enlighet med detta.

(8)

De föreslagna ändringarna bör tillämpas från och med räkenskapsåret 2018.

(9)

De åtgärder som föreskrivs i denna förordning är förenliga med yttrandet från kommittén för informationssystemet för jordbruksföretagens redovisningsuppgifter.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

Genomförandeförordning (EU) 2015/220 ska ändras på följande sätt:

1.

I artikel 3.2 ska följande stycke läggas till:

”Tyskland, Grekland, Ungern, Rumänien och Finland ska revidera de respektive urvalsplaner som de anmält för räkenskapsåret 2018. De ska senast den 31 mars 2018 anmäla sina respektive reviderade urvalsplaner för det räkenskapsåret till kommissionen.”

2.

Artikel 14 ska ersättas med följande:

”Artikel 14

Standardavgiftens storlek

1.   Den standardavgift som avses i artikel 19.1 a i förordning (EG) nr 1217/2009 ska uppgå till 160 euro per företagsredovisning.

2.   Om det tröskelvärde på 80 % som avses i artikel 19.1 a i förordning (EG) nr 1217/2009 inte nås vare sig för ett ISJR-område eller för den berörda medlemsstaten ska den minskning som avses i den bestämmelsen tillämpas endast på nationell nivå.

3.   Under förutsättning att skyldigheten att respektera tröskelvärdet på 80 % som avses i artikel 19.1 a i förordning (EG) nr 1217/2009 för ett ISJR-område eller en medlemsstat är fullgjord ska standardavgiften ökas med

a)

5 euro, om medlemsstaten sänder in de redovisningsuppgifter som avses i artikel 9 i denna förordning senast en månad före utgången av de relevanta tidsfrister som anges i artikel 10.3, eller

b)

7 euro under räkenskapsåret 2018 och 10 euro under räkenskapsåret 2019, om medlemsstaten sänder in de redovisningsuppgifter som avses i artikel 9 i denna förordning senast två månader före utgången av de relevanta tidsfrister som avses i artikel 10.3.

4.   2 euro för räkenskapsåret 2018 och 5 euro för räkenskapsåret 2019 kan läggas till den högre standardavgiften enligt punkt 3 a och b, om räkenskapsuppgifterna har kontrollerats av kommissionen i enlighet med artikel 13 b i denna förordning och de anses vara korrekt upprättade i enlighet med artikel 8.2 i förordning (EG) nr 1217/2009, antingen när de sändes in till kommissionen eller inom två månader från det datum då kommissionen informerade den insändande medlemsstaten om att de redovisningsuppgifter som sänts in inte har upprättats korrekt.”

3.

Bilagorna I, II och VIII ska ändras i enlighet med bilagan till den här förordningen.

Artikel 2

Denna förordning träder i kraft den sjunde dagen efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Den ska tillämpas från och med räkenskapsåret 2018.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Bryssel den 11 december 2017.

På kommissionens vägnar

Jean-Claude JUNCKER

Ordförande


(1)  EUT L 328, 15.12.2009, s. 27.

(2)  Kommissionens genomförandeförordning (EU) 2015/220 av den 3 februari 2015 om tillämpningsföreskrifter för rådets förordning (EG) nr 1217/2009 om upprättandet av ett informationssystem för jordbruksföretagens redovisningsuppgifter för att belysa inkomstförhållanden och andra ekonomiska förhållanden i jordbruksföretag inom Europeiska unionen (EUT L 46, 19.2.2015, s. 1).


BILAGA

Bilagorna I, II och VIII till genomförandeförordning (EU) 2015/220 ska ändras på följande sätt:

1.

I bilaga I

ska den post som gäller Rumänien ersättas med följande:

”Rumänien

4 000 ”

2.

Bilaga II ska ändras på följande sätt:

a)

De poster som avser Tyskland i tabellen om antalet rapporterande företag ska ersättas med följande:

”Referensnummer

ISJR-områdets namn

Antal rapporterande företag per räkenskapsår

 

TYSKLAND

015

Schleswig-Holstein/Hamburg

662

030

Niedersachsen

1 307

040

Bremen

050

Nordrhein-Westfalen

1 010

060

Hessen

558

070

Rheinland-Pfalz

887

080

Baden-Württemberg

1 190

090

Bayern

1 678

100

Saarland

90

110

Berlin

112

Brandenburg

284

113

Mecklenburg-Vorpommern

268

114

Sachsen

313

115

Sachsen-Anhalt

270

116

Thüringen

283

 

Totalt Tyskland

8 800 ”

b)

De poster som avser Grekland i tabellen om antalet rapporterande företag ska ersättas med följande:

”Referensnummer

ISJR-områdets namn

Antal rapporterande företag per räkenskapsår

 

GREKLAND

450

Μακεδονία – Θράκη (Makedonien-Thrakien)

1 700

460

Ήπειρος – Πελοπόννησος – Νήσοι Ιονίου (Epirus, Peloponnesos, Joniska öarna)

1 150

470

Θεσσαλία (Thessalien)

600

480

Στερεά Ελλάς – Νήσοι Αιγαίου – Κρήτη (Sterea Ellas, Egeiska öarna, Kreta)

1 225

 

Totalt Grekland

4 675 ”

c)

De poster som avser Ungern i tabellen om antalet rapporterande företag ska ersättas med följande:

”Referensnummer

ISJR-områdets namn

Antal rapporterande företag per räkenskapsår

 

UNGERN

767

Alföld

1 144

768

Dunántúl

733

764

Észak-Magyarország

223

 

Totalt Ungern

2 100 ”

d)

De poster som avser Rumänien i tabellen om antalet rapporterande företag ska ersättas med följande:

”Referensnummer

ISJR-områdets namn

Antal rapporterande företag per räkenskapsår

 

RUMÄNIEN

840

Nord-Est

724

841

Sud-Est

913

842

Sud-Muntenia

857

843

Sud-Vest-Oltenia

519

844

Vest

598

845

Nord-Vest

701

846

Centru

709

847

București-Ilfov

79

 

Totalt Rumänien

5 100 ”

e)

De poster som avser Finland i tabellen om antalet rapporterande företag ska ersättas med följande:

”Referensnummer

ISJR-områdets namn

Antal rapporterande företag per räkenskapsår

 

FINLAND

670

Södra Finland

420

680

Inre Finland

169

690

Österbotten

203

700

Norra Finland

108

 

Totalt Finland

900”

3.

Bilaga VIII ska ändras på följande sätt:

a)

Tabell D ska ändras på följande sätt:

i)

I andra tabellen ska posten för kategori ”2010 – Biologiska tillgångar – växter” ersättas med följande:

”Kod (*)

Beskrivning av kategorier

OV

AD

DY

IP

S

SA

CV

2010

Biologiska tillgångar – växter

 

 

 

 

 

 

ii)

Posten för tillgångskategori ”2010 Biologiska tillgångar – växter” ska ersättas med följande:

”2010   Biologiska tillgångar – växter

Värdet för alla plantor som ännu inte har skördats (alla permanenta grödor och grödor på rot). Ackumulerade avskrivningar (D.AD) och avskrivningar för aktuellt år (D.DY) bör endast rapporteras för fleråriga odlingar.”

iii)

Tabellen om värderingsmetoder ska ersättas med följande tabell:

”Verkligt värde minus uppskattade försäljningskostnader

Det belopp till vilket en tillgång skulle kunna överlåtas eller en skuld regleras mellan kunniga parter som är oberoende av varandra och har intresse av att transaktionen genomförs, minus den kostnad som uppskattas uppstå i samband med försäljningen

3010 , 5010 , 7010

Historisk kostnad

Nominell eller ursprunglig kostnad för en tillgång när den anskaffas

2010 , 3020 , 3030 , 4010 , 7020

Bokfört värde

Det värde med vilket en tillgång förs in i balansräkningen

1010 , 1020 , 1030 , 1040 , 8010 ”

b)

I förklaringarna till tabell H ska fjärde stycket ersättas med följande:

”Om de redovisade kostnaderna hänför sig till den totala ’förbrukningen’ av insatsvaror under räkenskapsåret men inte hör samman med produktionen under räkenskapsåret, bör förändringar i lager av insatsvaror (inklusive kostnader som hänför sig till odlingarna) redovisas i tabell D under kod 1040 – Lager.”

c)

I tabell M,

i avsnitt AI Administrativ information, ska tredje stycket ersättas med följande:

”Tillhandahållandet av de uppgifter som avses i kolumnen Antalet basenheter (N) är frivilligt under räkenskapsåren 2015–2017 för koderna 10300–10319.”


12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/17


KOMMISSIONENS GENOMFÖRANDEFÖRORDNING (EU) 2017/2281

av den 11 december 2017

om godkännande av en höjning av gränsvärdena för berikning av vin som produceras av druvor som skördats under 2017 i vissa vinodlingsområden i Tyskland och i alla vinodlingsområden i Danmark, Nederländerna och Sverige

EUROPEISKA KOMMISSIONEN HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om Europeiska unionens funktionssätt,

med beaktande av Europaparlamentets och rådets förordning (EU) nr 1308/2013 av den 17 december 2013 om upprättande av en samlad marknadsordning för jordbruksprodukter och om upphävande av rådets förordningar (EEG) nr 922/72, (EEG) nr 234/79, (EG) nr 1037/2001 och (EG) nr 1234/2007 (1), särskilt artikel 91, och

av följande skäl:

(1)

I del I punkt A.3 i bilaga VIII till förordning (EU) nr 1308/2013 fastställs att medlemsstaterna under år med ovanligt ogynnsamma väderförhållanden får begära att gränsvärdena för höjning av alkoholhalten (berikning) i volymprocent i vin får höjas med upp till 0,5 procentenheter.

(2)

Danmark, Tyskland, Nederländerna och Sverige har begärt sådana höjningar av gränsvärdena för berikning för vin som produceras av druvor som skördats under 2017, eftersom väderförhållandena under växtsäsongen har varit ovanligt ogynnsamma. Danmarks, Nederländernas och Sveriges begäran avser alla vinodlingsområden i landet. Tysklands begäran avser endast vin som framställs av den röda druvsorten Dornfelder i områdena Ahr, Mittelrhein, Mosel, Nahe, Pfalz och Rheinhessen.

(3)

På grund av de ovanligt ogynnsamma väderförhållandena under 2017 möjliggör inte de gränsvärden för höjning av den naturliga alkoholhalten som föreskrivs i del I punkt A.2 i bilaga VIII till förordning (EU) nr 1308/2013 produktion av vin med lämplig total alkoholhalt från alla eller vissa av de druvsorter i vissa vinodlingsområden som normalt efterfrågas på marknaden.

(4)

Det är därför lämpligt att tillåta en höjning av gränsvärdena för berikning av vin som produceras av samtliga eller vissa druvsorter som skördats 2017 i vinodlingsområden i Danmark, Tyskland, Nederländerna och Sverige.

(5)

De åtgärder som föreskrivs i denna förordning är förenliga med yttrandet från kommittén för den samlade marknadsordningen inom jordbruket.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

I de vinodlingsområden eller delar därav som anges i bilagan till denna förordning och för alla eller vissa druvsorter som anges i den bilagan får, genom undantag från del I punkt A.2 i bilaga VIII till förordning (EU) nr 1308/2013, höjningen av den naturliga alkoholhalten i volymprocent i färska druvor skördade under 2017, druvmust, delvis jäst druvmust, och ungt, icke färdigjäst vin och vin som produceras av druvor som skördats 2017 inte överstiga 3,5 volymprocent.

Artikel 2

Denna förordning träder i kraft den tredje dagen efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Bryssel den 11 december 2017.

På kommissionens vägnar

Jean-Claude JUNCKER

Ordförande


(1)  EUT L 347, 20.12.2013, s. 671.


BILAGA

Druvsorter och vinodlingsområden eller delar därav där en höjning av gränsvärdena för berikning är tillåten i enlighet med artikel 1

Medlemsstat

Vinodlingsområden eller delar därav (vinodlingszon)

Sort

Danmark

Alla vinodlingsområden (zon A)

Alla godkända druvsorter

Tyskland

Vinodlingsområdet i Ahr (zon A)

Dornfelder

Vinodlingsområdet i Mittelrhein (zon A)

Vinodlingsområdet i Mosel (zon A)

Vinodlingsområdet i Nahe (zon A)

Vinodlingsområdet i Pfalz (zon A)

Vinodlingsområdet i Rheinhessen (zon A)

Nederländerna

Alla vinodlingsområden (zon A)

Alla godkända druvsorter

Sverige

Alla vinodlingsområden (zon A)

Alla godkända druvsorter


BESLUT

12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/19


RÅDETS BESLUT (GUSP) 2017/2282

av den 11 december 2017

om ändring av beslut 2010/788/Gusp om restriktiva åtgärder mot Demokratiska republiken Kongo

EUROPEISKA UNIONENS RÅD HAR ANTAGIT DETTA BESLUT

med beaktande av fördraget om Europeiska unionen, särskilt artikel 29,

med beaktande av förslaget från unionens höga representant för utrikes frågor och säkerhetspolitik, och

av följande skäl:

(1)

Den 20 december 2010 antog rådet beslut 2010/788/Gusp (1) om restriktiva åtgärder mot Demokratiska republiken Kongo.

(2)

Den 12 december 2016 antog rådet beslut (Gusp) 2016/2231 (2) med anledning av hindrandet av valprocessen och de därmed sammanhängande människorättskränkningarna i Demokratiska republiken Kongo. Genom rådets beslut (Gusp) 2016/2231 ändrades beslut 2010/788/Gusp och infördes autonoma restriktiva åtgärder i enlighet med artikel 3.2.

(3)

På grundval av en översyn av de åtgärder som avses i artikel 3.2 i beslut 2010/788/Gusp bör de restriktiva åtgärderna förlängas till och med den 12 december 2018.

(4)

Beslut 2010/788/Gusp bör ändras i enlighet med detta.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

Artikel 9.2 i beslut 2010/788/Gusp ska ersättas med följande:

”2.   De åtgärder som avses i artikel 3.2 ska tillämpas till och med den 12 december 2018. De ska förlängas eller vid behov ändras, om rådet bedömer att målen för åtgärderna inte har uppnåtts.”

Artikel 2

Detta beslut träder i kraft dagen efter det att det har offentliggjorts i Europeiska unionens officiella tidning.

Utfärdat i Bryssel den 11 december 2017.

På rådets vägnar

F. MOGHERINI

Ordförande


(1)  Rådets beslut 2010/788/Gusp av den 20 december 2010 om restriktiva åtgärder mot Demokratiska republiken Kongo och om upphävande av gemensam ståndpunkt 2008/369/Gusp (EUT L 336, 21.12.2010, s. 30).

(2)  Rådets beslut (Gusp) 2016/2231 av den 12 december 2016 om ändring av beslut 2010/788/Gusp om restriktiva åtgärder mot Demokratiska republiken Kongo (EUT L 336 I, 12.12.2016, s. 7).


12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/20


RÅDETS BESLUT (GUSP) 2017/2283

av den 11 december 2017

till stöd för en global rapporteringsmekanism för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition avsedd att minska risken för olaglig handel med dessa (”iTrace III”)

EUROPEISKA UNIONENS RÅD HAR ANTAGIT DETTA BESLUT

med beaktande av fördraget om Europeiska unionen, särskilt artiklarna 28.1 och 31.1,

med beaktande av förslaget från unionens höga representant för utrikes frågor och säkerhetspolitik, och

av följande skäl:

(1)

I EU:s globala strategi för Europeiska unionens utrikes- och säkerhetspolitik från 2016 (nedan kallad EU:s globala strategi) betonas det att unionen kommer att främja fred och garantera säkerhet för sina medborgare och sitt territorium och i högre grad bidra till Europas kollektiva säkerhet.

(2)

Olaglig tillverkning, överföring och spridning av konventionella vapen, inklusive handeldvapen och lätta vapen, liksom extrem anhopning och okontrollerad spridning är centrala inslag i denna utmaning, både inom och utanför Europa. Denna olagliga verksamhet vållar bristande säkerhet i Europa och dess grannskap samt många andra regioner i världen, förvärrar konflikter och undergräver fredsbevarande åtgärder efter konflikter, och utgör därmed ett allvarligt hot mot fred och säkerhet i Europa.

(3)

I EU:s strategi av den 16 december 2005 för kampen mot olaglig anhopning av och handel med handeldvapen och lätta vapen och ammunition till dessa (nedan kallad EU-strategin för handeldvapen och lätta vapen), där det fastställs riktlinjer för unionens åtgärder inom området för handeldvapen och lätta vapen, framhålls det att handeldvapen och lätta vapen bidrar till att förvärra terrorismen och den organiserade brottsligheten samt utgör en viktig faktor vid utbrott och spridning av konflikter liksom vid upplösning av staters strukturer.

(4)

Enligt EU-strategin för handeldvapen och lätta vapen ska unionen också förstärka och stödja systemen för övervakning av påföljderna samt stödja förstärkt exportkontroll och främjande av rådets gemensamma ståndpunkt 2008/944/Gusp (1), bl.a. genom att främja åtgärder för öppenhet.

(5)

Genom FN:s handlingsprogram för att förebygga, bekämpa och utrota alla former av olaglig handel med handeldvapen och lätta vapen (nedan kallat FN:s handlingsprogram), som antogs den 20 juli 2001, har alla FN:s medlemsstater åtagit sig att förebygga olaglig handel med handeldvapen och lätta vapen, eller avledning av sådana vapen till obehöriga mottagare, och särskilt att vid bedömningen av ansökningar om exporttillstånd beakta risken för att handeldvapen och lätta vapen avleds till den olagliga handeln.

(6)

Den 8 december 2005 antog FN:s generalförsamling ett internationellt instrument för att möjliggöra för stater att i tid och på ett tillförlitligt sätt identifiera och spåra olagliga handeldvapen och lätta vapen.

(7)

Vid den andra översynskonferensen 2012 om FN:s handlingsprogram bekräftade alla FN:s medlemsstater sitt engagemang för att förebygga olaglig handel med handeldvapen och lätta vapen, inklusive avledning av sådana vapen till obehöriga mottagare, samt sina åtaganden enligt FN:s handlingsprogram vad gäller bedömningen av ansökningar om exporttillstånd.

(8)

Den 24 december 2014 trädde vapenhandelsfördraget i kraft. Syftet med det fördraget är att fastställa högsta möjliga gemensamma internationella normer för att reglera eller förbättra regleringen av den internationella handeln med konventionella vapen, förebygga och utplåna olaglig handel med konventionella vapen samt förhindra avledning av sådana vapen. Unionen bör stödja alla FN:s medlemsstater vid genomförandet av effektiva kontroller av vapenöverföring i syfte att säkerställa att vapenhandelsfördraget blir så verkningsfullt som möjligt, särskilt med avseende på genomförandet av artikel 11.

(9)

Unionen har tidigare gett sitt stöd till Conflict Armament Research Ltd. (CAR) genom rådets beslut 2013/698/Gusp (2) och rådets beslut (Gusp) 2015/1908 (3) (iTrace I och II).

(10)

Unionen önskar finansiera iTrace III, den tredje fasen av denna globala rapporteringsmekanism för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition. Detta kommer att minska risken för olaglig handel med dessa och bidra till att ovannämnda mål uppnås, inbegripet genom att i tid tillhandahålla relevant information om handeln med olagliga vapen till nationella vapenexportmyndigheter i syfte att bidra till Europas kollektiva säkerhet, såsom begärdes i EU:s globala strategi.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

I syfte att genomföra EU:s globala strategi och EU-strategin för handeldvapen och lätta vapen samt i syfte att främja fred och säkerhet ska de projektverksamheter som stöds av unionen ha följande specifika mål:

Att fortsätta underhållet av ett användarvänligt globalt informationshanteringssystem för handeldvapen och lätta vapen som har avletts eller varit föremål för olaglig handel och andra konventionella vapen och ammunition som har avletts eller varit föremål för olaglig handel (nedan kallat iTrace), vilka har dokumenterats i konfliktdrabbade områden i syfte att tillhandahålla relevant information till politiskt ansvariga, experter på kontroll av konventionella vapen och tjänstemän med ansvar för kontroll av export av konventionella vapen, så att de kan utveckla effektiva, faktabaserade strategier och projekt mot den olagliga spridningen av handeldvapen och lätta vapen och andra konventionella vapen och ammunition.

Att utbilda och ge råd till nationella myndigheter i konfliktdrabbade stater för att utveckla en hållbar nationell kapacitet för identifiering och spårning av olagliga vapen, uppmuntra till varaktigt samarbete med iTrace-projektet, bättre identifiera prioriteringar avseende fysisk säkerhet och lagerhantering, framföra krav avseende bistånd med nationell vapenkontroll och upprätthållande av lagen (framför allt EU-finansierade initiativ såsom iARMS) samt stärka dialogen med EU:s uppdrag och initiativ.

Att utöka frekvensen och varaktigheten för fältforskningen om handeldvapen och lätta vapen samt andra konventionella vapen och ammunition som sprids illegalt i konfliktdrabbade områden för att generera iTrace-data, i syfte att efterkomma tydliga krav från medlemsstaterna och unionsdelegationerna.

Att tillhandahålla direkt stöd till medlemsstaternas myndigheter för vapenexportkontroll och politiskt ansvariga för vapenkontroll, bl.a. genom återkommande rådgivningsbesök av iTrace-projektets personal i medlemsstaternas huvudstäder, en dygnetruntöppen helpdesk för att snabb rådgivning om riskbedömning och strategier för förebyggande av avledning, utveckling av säkra applikationer med infopaneler för stationära och mobila enheter där man omedelbart aviseras om avledning efter export samt på begäran tillhandahållande av kontroll efter leverans till medlemsstaterna från iTrace-projektets personal.

Att öka medvetenheten genom uppsökande verksamhet i fråga om projektresultaten, främja syftet med iTrace-mekanismen och dess tillgängliga funktioner för internationella och nationella politiskt ansvariga, experter på kontroll av konventionella vapen och myndigheter som utfärdar vapenexportlicenser samt förbättra den internationella kapaciteten att övervaka den olagliga spridningen av handeldvapen och lätta vapen och andra konventionella vapen och ammunition och bistå de politiskt ansvariga vid identifieringen av prioriterade områden för internationellt bistånd och samarbete samt minska risken för avledning av handeldvapen och lätta vapen och andra konventionella vapen och ammunition.

Att tillhandahålla rapporter om centrala policyfrågor, vilka bygger på data som tagits fram med hjälp av fältundersökningar och som presenteras genom iTrace-systemet och vilka rör särskilda områden som förtjänar internationell uppmärksamhet, inklusive de övergripande mönstren för den olagliga handeln med handeldvapen och lätta vapen och andra konventionella vapen och ammunition, samt den regionala fördelningen av vapen och ammunition som varit föremål för olaglig handel.

Unionen ska finansiera detta projekt, som beskrivs närmare i bilagan till detta beslut.

Artikel 2

1.   Unionens höga representant för utrikes frågor och säkerhetspolitik (den höga representanten) ska ansvara för genomförandet av detta beslut.

2.   Det tekniska genomförandet av det projekt som avses i artikel 1 ska utföras av Conflict Armament Research Ltd. (CAR).

3.   CAR ska utföra sina uppgifter under överinseende av den höga representanten. Den höga representanten ska i detta syfte ingå nödvändiga överenskommelser med CAR.

Artikel 3

1.   Det finansiella referensbeloppet för genomförandet av det projekt som avses i artikel 1 ska vara 3 474 322,77 EUR. Den sammanlagda beräknade budgeten för hela projektet ska vara 3 993 676,97 EUR, som ska tillhandahållas genom medfinansiering från CAR och det tyska utrikesministeriet.

2.   De utgifter som finansieras med det belopp som anges i punkt 1 ska förvaltas i enlighet med de förfaranden och regler som gäller för unionens allmänna budget.

3.   Kommissionen ska övervaka att det finansiella referensbelopp som avses i punkt 1 förvaltas korrekt. Den ska därför ingå den överenskommelse som krävs med CAR. I överenskommelsen ska det fastställas att CAR ska säkerställa att unionens bidrag synliggörs i proportion till sin storlek.

4.   Kommissionen ska eftersträva att ingå den överenskommelse som avses i punkt 3 så snart som möjligt efter det att detta beslut har trätt i kraft. Den ska underrätta rådet om eventuella svårigheter i samband med detta och om dagen för överenskommelsens ingående.

Artikel 4

1.   Den höga representanten ska rapportera till rådet om genomförandet av detta beslut på grundval av regelbundet återkommande beskrivande kvartalsrapporter som utarbetas av CAR. Dessa rapporter ska ligga till grund för rådets utvärdering. En extern enhet ska utvärdera projektet för att bistå rådet i dess utvärdering av resultaten av detta rådsbeslut.

2.   Kommissionen ska rapportera om de finansiella aspekterna av det projekt som avses i artikel 1.

Artikel 5

1.   Detta beslut träder i kraft samma dag som det antas.

2.   Detta beslut upphör att gälla 24 månader efter det att den överenskommelse som avses i artikel 3.3 har ingåtts. Det ska dock upphöra att gälla sex månader efter ikraftträdandet, om det inte har ingåtts någon överenskommelse under den perioden.

Utfärdat i Bryssel den 11 december 2017.

På rådets vägnar

F. MOGHERINI

Ordförande


(1)  Rådets gemensamma ståndpunkt 2008/944/Gusp av den 8 december 2008 om fastställande av gemensamma regler för kontrollen av export av militär teknik och krigsmat (EUT L 335, 13.12.2008, s. 99).

(2)  Rådets beslut 2013/698/Gusp av den 25 november 2013 till stöd för en global rapporteringsmekanism för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition avsedd att minska risken för olaglig handel med dessa (EUT L 320, 30.11.2013, s. 34).

(3)  Rådets beslut (Gusp) 2015/1908 av den 22 oktober 2015 till stöd för en global rapporteringsmekanism för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition avsedd att minska risken för olaglig handel med dessa (”iTrace II”) (EUT L 278, 23.10.2015, s. 15).


BILAGA

iTrace – den globala rapporteringsmekanismen för handeldvapen och lätta vapen samt andra konventionella vapen och ammunition

1.   Bakgrund och motivering till stödet inom ramen för den gemensamma utrikes- och säkerhetspolitiken (Gusp)

1.1

Detta beslut bygger på flera på varandra följande rådsbeslut om kampen mot de destabiliserande effekterna av avledning av och olaglig handel med handeldvapen och lätta vapen samt andra konventionella vapen, framför allt rådets beslut 2013/698/Gusp av den 25 november 2013 (1) och rådets beslut (Gusp) 2015/1908 av den 22 oktober 2015 (2), genom vilka den globala rapporteringsmekanismen för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition (iTrace) inrättades och förstärktes.

Den olagliga spridningen av handeldvapen och lätta vapen och andra konventionella vapen och ammunition är en viktig faktor som undergräver staters stabilitet och förvärrar konflikter, vilket utgör ett allvarligt hot mot fred och säkerhet. Såsom anges i EU:s strategi för kampen mot olaglig anhopning av och handel med handeldvapen och lätta vapen och ammunition till dessa (nedan kallad EU-strategin för handeldvapen och lätta vapen) bidrar olagliga vapen och ammunition till att förvärra terrorismen och den organiserade brottsligheten och utgör en viktig faktor vid utbrott och spridning av konflikter samt vid upplösning av staters strukturer. Den senaste tidens rön från iTrace-projektet i Irak, Libyen, Syrien och andra komplicerade konflikter nära unionens yttre gränser bekräftar det som framhålls i EU-strategin för handeldvapen och lätta vapen.

Genom den verksamhet som bedrivits inom ramen för beslut (Gusp) 2015/1908 har det lanserats ett globalt initiativ – iTrace – för övervakning av vapen i konflikter. Verksamhet pågår i 27 konfliktdrabbade stater, bl.a. i Afrika, Mellanöstern, södra och östra Asien samt på senare tid Latinamerika. iTrace är världens största offentliga databas över avledda konventionella vapen i syfte att stödja stater i deras ansträngningar att upptäcka och angripa problemet med avledning i linje med åtagandena enligt artikel 11 i vapenhandelsfördraget och kriterium 7 i rådets gemensamma ståndpunkt 2008/944/Gusp (3). iTrace tillhandahåller noggrann rapportering om leveranser av vapen och ammunition till väpnade rebell- och terroristgrupper som utgör ett hot mot unionens säkerhet, däribland al-Qaida i islamiska Maghreb och Daish eller Islamiska staten. iTrace ger konfidentiella och snabba varningar till medlemsstaternas exportkontrollmyndigheter om risker för avledning efter export och avgörande information i realtid till unionens delegationer och medlemsstaternas diplomatiska beskickningar i konfliktdrabbade regioner rörande olaglig vapenhandel och konfliktdynamik; samt ökad medvetenhet om åtgärder för vapenkontroll och förebyggande av avledning genom ofta återkommande medverkan i globala medier med stor genomslagskraft.

1.2

Från medlemsstaterna hörs det dock alltfler krav på att iTrace-projektet ska tillhandahålla direkta, personliga briefingar till nationella myndigheter som utfärdar vapenexportlicenser (inklusive täta besök i huvudstäderna) och tillhandahålla ännu fler resurser för politiskt ansvariga för vapenexportkontroll.

Syftet med detta beslut är därför att fortsätta med och utveckla det projektarbete som genomförts inom ramen för beslut (Gusp) 2015/1908 genom att ge unionens politiskt ansvariga, vapenkontrollexperter och vapenexportkontrolltjänstemän systematiskt sammanställd, relevant information till stöd för dem i arbetet med att utveckla effektiva, faktabaserade strategier för att motverka avledning och olaglig spridning av konventionella vapen och ammunition till dessa i syfte att förbättra den internationella och regionala säkerheten. Beslutet kommer således att fortsätta vara till stöd för dem när det gäller att kombinera en framgångsrik reaktiv strategi med lämpliga förebyggande åtgärder för att komma till rätta med det olagliga utbudet och den olagliga efterfrågan och för att säkerställa en effektiv kontroll av konventionella vapen i tredjeländer.

1.3

Detta beslut innebär fortsatt underhåll och ytterligare förbättring av det offentliga onlinesystemet iTrace. De projekt som anges i beslut (Gusp) 2015/1908 kommer att förstärkas genom 1) ökad frekvens och varaktighet för uppdrag som samlar in data om olagliga leveranser av konventionella vapen till konfliktdrabbade regioner,2) specialanpassade supportpaket till unionens medlemsstater som omfattar direkta sökningar, specialbeställda data och rapporter, en dygnetruntöppen helpdesk samt kontroller efter leverans och 3) utbildning och handledning av nationella myndigheter i konfliktdrabbade stater för kapacitetsuppbyggnad avseende förebyggande av avledning, bättre vapenförvaltning och bättre insamling av iTrace-data.

2.   Övergripande mål

Den åtgärd som beskrivs nedan ska ytterligare stödja det internationella samfundet i kampen mot de destabiliserande effekterna av avledning av och olaglig handel med handeldvapen och lätta vapen och andra konventionella vapen och ammunition. Den kommer att fortsätta ge politiskt ansvariga, vapenkontrollexperter och vapenexportkontrolltjänstemän relevant information till stöd för dem i arbetet med att utveckla effektiva, faktabaserade strategier för att motverka avledning och olaglig spridning av handeldvapen och lätta vapen och andra konventionella vapen och ammunition i syfte att förbättra den internationella och regionala säkerheten. Åtgärden ska särskilt

a)

ge nödvändig konkret information om den olagliga handeln med handeldvapen och lätta vapen och andra konventionella vapen för en effektivare övervakning av genomförandet av FN:s handlingsprogram om olaglig handel med handeldvapen och lätta vapen,

b)

stärka genomförandet av det internationella spårningsinstrumentet,

c)

exponera de viktigaste rutter och enheter som är involverade i avledningen av konventionella vapen och ammunition till konfliktdrabbade regioner eller till internationella terroristorganisationer samt, till stöd för nationella rättsliga förfaranden, tillhandahålla bevismaterial om grupper och enskilda personer som ägnar sig åt olaglig handel,

d)

intensifiera samarbetet mellan relevanta FN-organ, uppdrag och andra internationella organisationer när det gäller spårning av handeldvapen och lätta vapen och andra konventionella vapen samt direkt tillhandahållande av information till stöd för befintliga övervakningsmekanismer, inklusive Interpols register- och spårningssystem för olagliga vapen (iARMS), vilket kompletterar iTrace och med vilket samordning kommer att säkerställas,

e)

tillhandahålla relevant information i syfte att identifiera prioriterade områden för internationellt samarbete och bistånd för en effektiv kamp mot avledning av och olaglig handel med handeldvapen och lätta vapen och andra konventionella vapen och ammunition, såsom finansiering för projekt som rör lagersäkerhet eller gränsförvaltning,

f)

erbjuda en mekanism som bidrar till att övervaka genomförandet av vapenhandelsfördraget, särskilt i syfte att upptäcka avledning av överförda konventionella vapen samt bistå regeringar vid bedömningen av risken för avledning före export av konventionella vapen, särskilt risken för avledning inom köparlandet eller återexport under icke önskvärda förhållanden samt

g)

tillhandahålla skräddarsytt stöd till medlemsstaterna för att bistå vid bedömning och reducering av riskerna för avledning.

3.   Projektets hållbarhet på lång sikt och resultat

Åtgärden ska ge en långsiktig ram för varaktig övervakning av den olagliga spridningen av handeldvapen och lätta vapen och andra konventionella vapen och ammunition. Den förväntas väsentligen öka den befintliga vapenrelaterade informationen och utgöra ett avsevärt stöd för det riktade utarbetandet av effektiva strategier för kontroll av konventionella vapen och vapenexportkontroll. Projektet ska särskilt

a)

bygga ut informationshanteringssystemet iTrace som ska säkerställa långsiktig insamling och analys av uppgifter om olagliga konventionella vapen,

b)

ge politiskt ansvariga och experter inom kontroll av konventionella vapen ett verktyg för att fastställa effektivare strategier och prioriterade områden för bistånd och samarbete (till exempel genom identifiering av subregionala eller regionala mekanismer för samarbete, samordning och informationsutbyte som behöver inrättas eller förbättras eller genom identifiering av osäkra nationella lager, otillräcklig lagerhantering, olagliga överföringsrutter, bristfälliga gränskontroller eller otillräcklig brottsbekämpande kapacitet),

c)

omfatta en inbyggd flexibilitet att ta fram policyrelevant information, oberoende av de snabbt föränderliga policykraven,

d)

på ett grundläggande sätt öka effektiviteten hos internationella organisationer verksamma inom vapenövervakning och hos enskilda personer genom att tillhandahålla en mekanism för informationsutbyte vars räckvidd kontinuerligt utvidgas, och

e)

bygga upp hållbar nationell kapacitet i konfliktdrabbade stater för att identifiera och spåra olagliga vapen och på ett effektivare sätt delta i internationella förfaranden för vapenkontroll och brottsbekämpning.

4.   Beskrivning av åtgärden

4.1   Projekt 1: Utbilda och ge råd till nationella myndigheter i konfliktdrabbade stater när det gäller identifiering och internationell spårning av vapen.

4.1.1   Projektets mål

Projektet ska ge utbildning ”på begäran” i identifiering, spårning och förvaltning av vapen till lokala partner och, när så krävs, fredsstödjande personal (inbegripet FN- och unionsuppdrag och grupper eller paneler för sanktionsövervakning). Utbildningen kommer att bygga på ett antal tjänster som har erbjudits av CAR sedan 2014 – om än med budget vid sidan av projekten iTrace I och II – som har visat sig vara mycket viktiga för projekten.

4.1.2   Projektverksamheter

I projektet kommer personal från fältundersökningsgrupperna att utplaceras för att undervisa på stegvis mer tekniska nivåer, som omfattar

a)

en introduktion i vapendatainsamling, med hänvisningar till särskilda fall,

b)

grundläggande vapenidentifiering och ändamålsenliga tekniker för vapendokumentering,

c)

standardiserade tillvägagångssätt för insamling av bevisning samt spårning i bevissyfte,

d)

kraven på långväga, regionala och internationella undersökningar,

e)

genomförandet av det internationella spårningsinstrumentet,

f)

internationell spårning av vapen och internationella system för spårning av vapen (främst Interpol och Europol),

g)

användningen av ”stordata” och analyser av tendenser, och

h)

kanaler för tekniskt bistånd (internationellt) och brottsbekämpningsinsatser.

Dessa verksamheter kommer att bedrivas parallellt med fältundersökningarna inom iTrace – inbegripet gemensamma undersökningar (rådgivning) som genomförs tillsammans med nationella statliga myndigheter.

4.1.3   Projektresultat

Projektet ska

a)

uppmana nationella myndigheter att bevilja större tillträde för iTraces-systemets fältundersökningsgrupper – för att tillmötesgå de upprepade förfrågningarna till iTrace-grupperna om att tillhandahålla tekniskt bistånd och kapacitet för gemensamma undersökningar, och så att det resulterar i mer omfattande data i iTrace-systemet,

b)

tillhandahålla konkret kapacitetsuppbyggnadsstöd till regeringar i stater som plågas av följderna av vapenavledning men som saknar redskap för att kunna identifiera och rapportera om vapen som avletts vid konflikter – detta är ofta en situation som föregår en mer effektiv nationell vapenförvaltning och utgör därför, i sig, ett stöd för genomförandet av vapenhandelsfördraget, det internationella spårningsinstrumentet och FN:s handlingsprogram samt program för fysisk säkerhet och lagerhantering liksom samarbetet med internationella brottsbekämpande organ, däribland Interpol (iARMS) och Europol,

(c)

stödja utökad dialog – särskilt genom identifiering av intressenter som är viktiga för andra unionsstödda initiativ (t.ex. förbindelserna mellan unionsuppdrag och regeringar i värdländer) och initiativ för att få fart på utvecklingen, såsom program för fysisk säkerhet och lagerhantering (t.ex. unionsstödda lagerhanteringsprojekt).

4.1.4   Indikatorer för projektgenomförande

Upp till 30 besök för utbildning och rådgivning på fältet, med tonvikt på upprepade besök för att stödja nationella myndigheter i deras uppbyggnad av spårningskapacitet.

Projektet ska genomföras under hela den två år långa projektperioden för iTrace.

4.1.5   Projektmottagare

iTrace-programmets utbildnings- och rådgivningsverksamhet kommer att medföra direkta fördelar för nationella intressenter i konfliktdrabbade stater, inbegripet brottsbekämpande organ och åklagare. Programmet kommer att erbjuda indirekt stöd till nationella dialoger med unionsfinansierade och andra vapenkontrollinitiativ, och uppmuntra till användning av internationella spårningsmekanismer (inbegripet Interpols iARMS-system och Europol) och underlätta samarbete med unionsstödda lagerhanteringsprojekt och andra projekt för kontroll av handeldvapen och lätta vapen.

4.2   Projekt 2: Förbättrade fältundersökningar som behövs för att i ökad utsträckning, i realtid, förse iTrace-systemet med dokumenterad bevisning gällande avledning av och olaglig handel med handeldvapen och lätta vapen och andra konventionella vapen och ammunition och annan relevant information.

4.2.1   Projektets mål

Projektet ska leda till ökad frekvens och varaktighet för forskning på fältet om spridning av handeldvapen och lätta vapen och andra konventionella vapen och ammunition som cirkulerar i konfliktdrabbade områden. I projektet kommer länder av särskilt intresse för medlemsstaterna att prioriteras, inbegripet, bland andra, Irak, Libyen, Mali, Sydsudan, Somalia, Syrien och Jemen.

Formella avtal om informationsutbyte kommer att upprättas med unions- och FN-uppdrag och med ett antal organisationer, och ett selektivt sändande av formella spårningsbegäranden till nationella regeringar kommer att vidtas; båda åtgärdena kommer att bidra till projektet. Därutöver kommer projektet att fortsätta att utföra sekundärforskning om och kontrollera (genom fältundersökningar) befintliga uppgifter om relevanta överföringar som inhämtats från andra organisationer än CAR, så att de kan införas i iTrace-systemet.

4.2.2   Projektverksamheter

Följande verksamheter ska genomföras inom ramen för detta projekt:

a)

Utnyttja kvalificerade vapenexperter för att utföra fältanalyser av olagliga handeldvapen och lätta vapen och andra konventionella vapen samt ammunition och tillhörande materiel som inhämtats från konfliktdrabbade stater.

b)

Analysera, granska och kontrollera dokumenterad bevisning rörande olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen, ammunition och användare av dessa, inbegripet bland annat: fotografier av vapen, vapendelar och märkning inuti och utanpå vapen; förpackningar; tillhörande transportdokumentation och resultat av fältundersökningar (användare, leverantörer och överföringsrutter).

c)

Granska och verifiera ny bevisning för olagliga handeldvapen och lätta vapen och andra konventionella vapen och ammunition som inhämtats av andra organisationer än CAR, inbegripet rapporter från FN:s grupper för sanktionsövervakning, det civila samhällets organisationer och internationella nyhetsmedier.

d)

Föra över all inhämtad och granskad bevisning till informationshanteringssystemet och onlineportalen för kartläggning iTrace.

e)

Identifiera och stödja lokala partner för att säkerställa att uppgifter till stöd för iTrace konsekvent samlas in under den föreslagna åtgärdens varaktighet och därefter.

f)

Fortsätta att samarbeta med nationella regeringar för att i förväg fastställa nationella kontaktpunkter, och en samarbetsmekanism, i syfte att tydliggöra räckvidden för CAR:s utredningar och undvika intressekonflikter innan utredningarna inleds.

Projektet ska genomföras stegvis under hela den två år långa projektperioden för iTrace.

4.2.3   Projektresultat

Projektet ska

a)

på plats i konfliktdrabbade regioner dokumentera de konkreta bevisen för att konventionella vapen och ammunition har avletts eller varit föremål för olaglig handel,

b)

verifiera och utveckla fall av olaglig handel med hjälp av bevis för att konventionella vapen och ammunition har avletts eller varit föremål för olaglig handel i alla regioner, vilka har inhämtats av CAR, organisationer som har fasta avtal om informationsutbyte med CAR samt i förekommande fall andra organisationer,

c)

tillhandahålla konkreta, visuella bevis för att konventionella vapen och ammunition har avletts eller varit föremål för olaglig handel, inbegripet fotografier av objekt, serienummer, fabriksmärkning, kartonger, packlistor, transportdokumentation och slutanvändarintyg,

d)

skriftligen redogöra för olaglig verksamhet, inbegripet rutter för olaglig handel, aktörer som är involverade i avledande eller olaglig överföring samt bedömningar av bidragande faktorer (inbegripet ineffektiv lagerhantering och säkerhet samt överlagda, av staten iscensatta nätverk för olaglig tillförsel),

e)

överföra de ovannämnda bevisen till informationshanteringssystemet och onlineportalen för kartläggning iTrace för att sprida dem i deras helhet till allmänheten och medlemsstaterna genom säkra stationära och mobila plattformar.

4.2.4   Indikatorer för projektgenomförandet

Upp till 50 utplaceringar på fältet (inbegripet förlängda utplaceringar vid behov) under hela tvåårsperioden för att få fram bevisning att överföra till informationshanteringssystemet och onlineportalen för kartläggning iTrace.

Projektet ska genomföras under hela den två år långa projektperioden för iTrace.

4.2.5   Projektmottagare

iTrace ska fortsätta att tillhandahålla allt mer uttömmande information, som uttryckligen i första hand är inriktad på medlemsstaternas politiskt ansvariga för vapenkontroll, myndigheter som utfärdar vapenexportlicenser samt unionens institutioner, byråer och uppdrag. Dessa unionsmottagare kommer också att få tillgång till konfidentiell information via säkra stationära och mobila plattformar som tillhandahålls av iTrace.

Den offentliga informationen kommer alltjämt att vara tillgänglig för alla mottagare inom och utanför unionen, särskilt politiskt ansvariga för vapenkontroll och myndigheter i tredjeländer som utfärdar vapenexportlicenser. Även regionala och internationella organisationer (inbegripet FN:s grupper för sanktionsövervakning, FN:s fredsbevarande uppdrag, UNODC, Unoda och Interpol), icke-statliga forskningsorganisationer (inbegripet Bonn International Center for Conversion – Bicc), Group for Research and Information on Peace and Security – Grip), Stockholms internationella fredsforskningsinstitut (Sipri) och Small Arms Survey), opinionsbildande organisationer (inbegripet Amnesty International och Human Rights Watch) samt internationella nyhetsmedier kommer att kunna utnyttja den information som publiceras av iTrace.

4.3   Projekt 3: Direktstöd till medlemsstaternas myndigheter för vapenexportkontroll och politiskt ansvariga för vapenkontroll

4.3.1   Projektets mål

iTrace-projektets personal kommer att ha ett nära samarbete med medlemsstaternas nationella myndigheter som utfärdar vapenexportlicenser. Den information som tillhandahålls av medlemsstaternas nationella myndigheter ska behandlas konfidentiellt och med vederbörlig respekt. iTrace kommer också att upprätthålla kontakterna med olika nationella myndigheter i tredjeländer som utfärdar vapenexportlicenser. Dessa förbindelser kommer att stödja flera avgörande aspekter av de internationella insatserna för att ta itu med avledning och olaglig handel med konventionella vapen och stärka de internationella åtgärderna för att motverka avledning, inbegripet

a)

tillhandahållande till myndigheter som utfärdar vapenexportlicenser av detaljerade data och bevis på dokumenterad avledning,

b)

på officiell begäran från medlemsstaternas nationella myndigheter som utfärdar vapenexportlicenser, stöd eller tillhandahållande av kapacitet till medlemsstaterna för kontroll efter leverans.

4.3.2   Projektverksamhet

Följande verksamheter ska genomföras inom ramen för detta projekt:

a)

Återkommande besök av iTrace-team hos berörda myndigheter i medlemsstaternas huvudstäder för att informera om frågor som rör åtgärder mot avledning och för att rapportera om internationella utredningar.

b)

En dygnetruntöppen helpdesk för omedelbar rådgivning om åtgärder mot avledning eller eventuella negativa pressuppgifter som grundas på obekräftade rapporter från tredje man.

c)

Specialanpassad utveckling för medlemsstaternas myndigheter som utfärdar exportlicenser av infopaneler online för strömning av säkra data från iTrace-systemet – med ”rödflaggning” av parter som tidigare har varit inblandade i avledning av vapen, profilering av högriskdestinationer samt realtidsrapportering om avledning av inhemskt tillverkade vapen.

d)

På officiell begäran från medlemsstaternas nationella myndigheter i som utfärdar vapenexportlicenser, stöd eller tillhandahållande av kontroll av slutanvändning efter leverans (verifiering) till medlemsstaterna från iTrace-projektets fältundersökningsgrupper.

Projektet ska genomföras under hela den två år långa projektperioden för iTrace.

4.3.3   Projektresultat

Projektet ska

a)

på begäran biträda medlemsstaternas myndigheter som utfärdar vapenexportlicenser med kartläggning av avledning efter export,

b)

tillhandahålla information till medlemsstaternas myndigheter som utfärdar vapenexportlicenser, till stöd för en fullständig riskanalys avseende avledning (i linje med vapenhandelsfördraget och gemensam ståndpunkt 2008/944/Gusp) innan exportlicenser beviljas,

c)

på begäran tillhandahålla kapacitet för kontroll efter leverans till medlemsstaternas myndigheter som utfärdar vapenexportlicenser,

d)

stödja medlemsstaternas politiskt ansvariga för vapenkontroll med information i realtid om utvecklingen i fråga om avledning och olaglig handel, till stöd för nationell medverkan i internationella politiska processer samt

e)

i tillämpliga fall och på begäran bistå medlemsstaternas nationella brottsbekämpande organ vid brottsutredningar.

4.3.4   Indikatorer för projektgenomförande

Konstruktion och utveckling, som utförs av systemkonstruktörerna bakom det nuvarande iTrace-systemet, av specialanpassade infopaneler för stationära och mobila enheter där live-information strömmas från säkra partitioner i iTrace-systemet till medlemsstaternas nationella myndigheter. En helpdesk som bemannas av iTrace-projektets personal för fullständig support till medlemsstaternas myndigheter för vapenexportkontroll och politiskt ansvariga för vapenkontroll. Upp till 30 besök i medlemsstaternas huvudstäder på begäran.

Projektet ska genomföras under hela den två år långa projektperioden för iTrace.

4.3.5   Projektmottagare

Alla intresserade medlemsstater. Besök i huvudstäderna och uppdrag som innebär kontroll efter leverans på begäran.

4.4   Projekt 4: Kontaktverksamhet inriktad på berörda parter samt internationell samordning

4.4.1   Projektets mål

Projektet ska lyfta fram nyttan med iTrace för internationella och nationella politiskt ansvariga, experter på kontroll av konventionella vapen samt myndigheter som utfärdar vapenexportlicenser. Initiativen inom den uppsökande verksamheten ska också vara utformade för att i ökad utsträckning samordna informationsutbytet och bygga upp hållbara partnerskap med enskilda personer och organisationer som kan ta fram information som kan överföras till iTrace-systemet.

4.4.2   Projektverksamhet

Följande verksamhet kommer att genomföras inom ramen för detta projekt, varvid det är viktigt att undvika överlappning med andra åtaganden, exempelvis utåtriktad verksamhet till stöd för vapenhandelsfördraget:

a)

Presentationer av iTrace-projektets personal vid relevanta internationella konferenser om alla aspekter av olaglig handel med konventionella vapen. Presentationerna ska vara utformade för att lyfta fram iTrace, med tonvikt på 1) dess konkreta nytta som ett stöd vid övervakningen av genomförandet av FN:s handlingsprogram, vapenhandelsfördraget och andra relevanta internationella instrument, 2) dess användbarhet vid identifieringen av prioriterade områden för internationellt bistånd och samarbete samt 3) dess användbarhet för myndigheter som utfärdar vapenexportlicenser som profileringsmekanism för riskbedömning.

b)

Presentationer av iTrace-projektets personal riktade till nationella regeringar och fredsbevarande insatser. Presentationerna ska vara utformade för att lyfta fram iTrace för relevanta uppdragsavdelningar, dels för att främja och utarbeta formella avtal om informationsutbyte som leder till att information kan tas fram och överföras till iTrace-systemet, dels för att bistå politiskt ansvariga vid identifieringen av prioriterade områden för internationellt bistånd och samarbete.

Projektet ska genomföras under hela den två år långa projektperioden för iTrace.

4.4.3   Projektresultat

Projektet ska

a)

visa nyttan med iTrace och konceptet med dokumentation, sammanställning och utbyte av data om avledning för nationella och internationella politiskt ansvariga som arbetar för att genomföra avtal för kontroll av konventionella vapen och vapenexport (FN:s handlingsprogram, vapenhandelsfördraget och andra relevanta internationella instrument) och utvärdera genomförandet av dem,

b)

tillhandahålla relevant information för att underlätta för politiskt ansvariga och experter på kontroll av konventionella vapen vid identifieringen av prioriterade områden för internationellt bistånd och samarbete samt planeringen av effektiva strategier mot avledning,

c)

förse myndigheter som utfärdar vapenexportlicenser med ingående information om iTrace och dess användbarhet vid riskbedömning, utöver dess funktion som kanal för ytterligare återkoppling och systemutvidgning,

d)

underlätta informationsutbyte mellan nationella regeringar och FN:s fredsbevarande insatser, inbegripet databehandling och analyser med hjälp av iTrace-systemet,

e)

underlätta nätverksbyggande för en växande grupp av experter på kontroll av konventionella vapen som utför utredningar på plats av avledning av och olaglig handel med konventionella vapen och ammunition,

f)

stärka den offentliga profilen för spårning av konventionella vapen och ammunition som ett medel för att bistå vid övervakningen av genomförandet av FN:s handlingsprogram, det internationella spårningsinstrumentet, vapenhandelsfördraget och andra internationella och regionala instrument för kontroll av vapen och vapenexport.

4.4.4   Indikatorer för projektgenomförande

Upp till 20 informationskonferenser med deltagande av iTrace-projektets personal. Presentationer av iTrace ska göras vid alla konferenser. Slutrapporten ska innehålla konferensdagordningar och korta sammanfattningar.

Projektet ska genomföras under hela den två år långa projektperioden för iTrace.

4.4.5   Projektmottagare

Se avsnitt 4.2.5 för en fullständig förteckning över mottagarna, som är desamma som mottagarna för detta projekt.

4.5   Projekt 5: iTrace-policyrapporter

4.5.1   Projektets mål

Projektet ska framställa rapporter om centrala policyfrågor baserade på de data som tagits fram genom fältundersökningar och som presenteras i iTrace-systemet. Rapporterna ska utformas för att lyfta fram specifika områden av internationellt intresse, bland annat övergripande mönster för olaglig handel med konventionella vapen och ammunition, den regionala fördelningen av vapen och ammunition som varit föremål för olaglig handel och prioriterade områden för internationell uppmärksamhet.

4.5.2   Projektverksamheter

Ingående analyser som utmynnar i sammanställning, granskning, redigering och publikation av upp till tio iTrace-policyrapporter.

4.5.3   Projektresultat

Projektet ska

a)

utarbeta upp till tio rapporter som var och en behandlar en fråga av internationellt intresse,

b)

säkerställa att iTrace-policyrapporterna distribueras till alla medlemsstater,

c)

planera en riktad uppsökande strategi för att säkerställa en maximal global täckning,

d)

upprätthålla åtgärdens synlighet på den politiska arenan och i internationella nyhetsmedier genom att bland annat informera om olagliga vapen som är av aktuellt intresse; tillhandahålla politiskt relevanta analyser till stöd för pågående förfaranden för vapenkontroll och skräddarsy rapporter för att skapa ett maximalt intresse i internationella nyhetsmedier.

4.5.4   Indikatorer för projektgenomförandet

Upp till tio iTrace-policyrapporter online som framställts under den tid som den föreslagna åtgärden omfattar och som spridits globalt.

.5.5   Projektmottagare

Se avsnitt 4.2.5 för en fullständig förteckning över mottagarna, som är desamma som mottagarna för detta projekt.

5.   Lokalisering

För projekt 1 och 2 krävs att experter på konventionella vapen i stor utsträckning utplaceras på fältet i konfliktdrabbade regioner. Dessa utplaceringar kommer att bedömas från fall till fall med hänsyn till säkerhet, tillgänglighet och tillgång till information. CAR har redan upprättat kontakter eller har redan pågående projekt i många av de berörda länderna. Projekt 3 ska genomföras i huvudstäderna (tillsammans med andra resor inom landet i enlighet med medlemsstaternas krav). Projekt 4 ska genomföras vid internationella konferenser och i samordning med nationella regeringar och relevanta organisationer världen över för att säkerställa största möjliga synlighet för projektet. Projekt 5 ska sammanställas i Belgien, Italien, Frankrike och Förenade kungariket.

6.   Löptid

De kombinerade projekten beräknas pågå sammanlagt 24 månader.

7.   Genomförandeorgan och unionens synlighet

Inom ramen för CAR arbetar små fältundersökningsgrupper med lokala försvars- och säkerhetsstyrkor, fredsbevarande eller fredsfrämjande personal och andra aktörer med uppdrag på säkerhetsområdet. När dessa styrkor eller uppdrag säkrar vapen eller platser för bevisinsamling tillvaratar CAR-personal alla tillgängliga bevis rörande vapen, tillhörande materiel och användargrupper. Därefter går CAR vidare med spårning av alla unikt identifierbara artiklar och genomför omfattande utredningar av vapenöverföringar, leveranser av militär utrustning och stöd till parter som utgör ett hot mot fred och stabilitet.

I samarbete med nationella myndigheter som utfärdar exportlicenser rekonstruerar CAR de leveranskedjor som ansvarar för tillförsel av vapen till väpnade konflikter – kartlägger olaglig verksamhet och avledning av vapen från lagliga till olagliga marknader. CAR dokumenterar all information i sitt globala vapenövervakningssystem – iTrace– som utgör världens största databas med data om vapen i konflikter, med över 100 000 poster om vapen i konflikter.

CAR använder denna information för att a) uppmärksamma medlemsstater på avledning av vapen och ammunition och b) möjliggöra riktade initiativ med åtgärder mot avledning, t.ex. reviderade exportkontrollåtgärder och internationella diplomatiska insatser.

Denna metod har visat sig leda till så gott som omedelbar upptäckt av avledning, då CAR:s fältundersökningsgrupper har underrättat medlemsstaterna om avledda vapen medan de fortfarande befinner sig i konfliktdrabbade områden (t.ex. på plats i Mosul, Irak). I vissa fall har CAR-grupper upptäckt otillåten vidareöverföring inom två månader av vapen direkt från fabriken.

Genom beslut (Gusp) 2015/1908 av den 22 oktober 2015 stöddes CAR i det fortsatta arbetet med och utvidgningen av iTrace-projektet, som inrättades genom beslut 2013/698/Gusp. Projekten – iTrace I och iTrace II – har inneburit att iTrace har befästs som ett viktigt initiativ för övervakning av vapen i konflikter över hela världen och gett direkt stöd till medlemsstaternas myndigheter som utfärdar exportlicenser och politiskt ansvariga för vapenkontroll.

Dessutom efterfrågades i unionens handlingsplan mot den olagliga handeln med och användningen av skjutvapen och sprängämnen av den 2 december 2015 att man skulle ”utöka användningen av iTrace” och det rekommenderades att nationella brottsbekämpande myndigheter skulle kontrollera eventuella upptäckter av vapen och ammunition mot uppgifterna i iTrace.

CAR ska vidta alla lämpliga åtgärder för att offentliggöra det faktum att åtgärden i sin helhet har finansierats av unionen. Sådana åtgärder kommer att genomföras i enlighet med den handbok om kommunikation och synliggörande av Europeiska unionens externa åtgärder som fastställts och publicerats av kommissionen.

CAR ska således säkerställa att unionens bidrag synliggörs, med lämpligt varumärke och offentliggörande som belyser unionens roll, säkerställer insyn i dess åtgärder och ökar medvetenheten om såväl motiven bakom beslutet som unionens stöd för beslutet och resultaten av detta stöd. Material som produceras inom ramen för projektet ska tydligt märkas med unionsflaggan i enlighet med unionens riktlinjer för korrekt användning och återgivning av flaggan.

8.   Rapportering

CAR ska en gång i kvartalet utarbeta en beskrivande rapport.


(1)  Rådets beslut 2013/698/Gusp av den 25 november 2013 till stöd för en global rapporteringsmekanism för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition avsedd att minska risken för olaglig handel med dessa (EUT L 320, 30.11.2013, s. 34).

(2)  Rådets beslut (Gusp) 2015/1908 av den 22 oktober 2015 till stöd för en global rapporteringsmekanism för olagliga handeldvapen och lätta vapen och andra olagliga konventionella vapen och ammunition avsedd att minska risken för olaglig handel med dessa (”iTrace II”) (EUT L 278, 23.10.2015, s. 15).

(3)  Rådets gemensamma ståndpunkt 2008/944/Gusp av den 8 december 2008 om fastställande av gemensamma regler för kontrollen av export av militär teknik och krigsmat (EUT L 335, 13.12.2008, s. 99).


12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/32


RÅDETS BESLUT (EU) 2017/2284

av den 11 december 2017

om tillhandahållande av stöd till stater i Afrika, Asien-Stillahavsområdet samt Latinamerika och Västindien för att delta i en samrådsprocess i den förberedande expertgruppen på hög nivå för ett fördrag om förbud mot framställning av klyvbart material för kärnvapen

EUROPEISKA UNIONENS RÅD HAR ANTAGIT DETTA BESLUT

med beaktande av fördraget om Europeiska unionen, särskilt artikel 28.1, och

av följande skäl:

(1)

Den 12 december 2003 antog Europeiska rådet EU:s strategi mot spridning av massförstörelsevapen (nedan kallad strategin) som i kapitel II innehåller en förteckning över åtgärder som ska vidtas för en effektiv multilateralism som är hörnstenen i den europeiska strategin för kampen mot spridning av massförstörelsevapen. Det framgår bland annat att ”EU ställer sig bakom systemet med multilaterala fördrag, som utgör den rättsliga och normativa grunden för alla icke-spridningsansträngningar” och att ”EU:s politik är att fortsätta att verka för ett internationellt avtal om förbud mot framställning av klyvbart material för tillverkning av kärnvapen eller andra kärnladdningar”.

(2)

EU genomför aktivt strategin och ger verkan åt de åtgärder som anges i kapitel III i strategin, särskilt genom att frigöra ekonomiska resurser för att ge stöd till särskilda projekt som syftar till att förbättra det multilaterala systemet för förhindrande av spridning och de multilaterala förtroendeskapande åtgärderna.

(3)

Den 8 december 2008 antog rådet sina slutsatser och ett dokument med titeln Nya handlingslinjer för Europeiska unionen i kampen mot spridning av massförstörelsevapen och bärarsystem för sådana vapen. Av dokumentet framgår bland annat att EU åtar sig att fortsätta och intensifiera sina insatser för att inleda förhandlingarna om ett fördrag om förbud mot framställning av klyvbart material för kärnvapen.

(4)

EU har konsekvent efterlyst ett omedelbart inledande och ett snabbt slutförande av förhandlingarna om ett fördrag om förbud mot framställning av klyvbart material för kärnvapen och andra kärnladdningar på grundval av dokument CD/1299 och mandatet i detta. I samma anda har EU uppmuntrat alla medlemmar i nedrustningskonferensen att göra sitt yttersta för att bryta dödläget i nedrustningskonferensen och anta ett övergripande och väl avvägt arbetsprogram som innebär att omedelbara förhandlingar inleds om ett fördrag om förbud mot framställning av klyvbart material för kärnvapen (FMCT).

(5)

2013 antog FN:s generalförsamling en resolution som inrättade en grupp med statliga experter från 25 stater, med uppgift att utarbeta rekommendationer om olika aspekter, som skulle bidra till men inte förhandla om ett fördrag om förbud mot framställning av klyvbart material för tillverkning av kärnvapen och andra kärnladdningar. Gruppen lade fram sin rapport till FN:s generalförsamlings första utskott (nedrustning) under 2015.

(6)

2016 antog FN:s generalförsamling resolution 71/259 om ett fördrag om förbud mot framställning av klyvbart material för kärnvapen och andra kärnladdningar. I resolution 71/259 uppmanas generalsekreteraren att inrätta en förberedande expertgrupp på hög nivå för ett fördrag om förbud mot FMCT med uppgift att utarbeta rekommendationer om väsentliga inslag i ett framtida icke-diskriminerande, multilateralt fördrag som faktiskt kan kontrolleras internationellt och som förbjuder framställning av klyvbart material för kärnvapen eller andra kärnladdningar. Den förberedande expertgruppen på hög nivå för ett fördrag om förbud mot FMCT kommer att vara sammansatt av 25 stater, och kommer att hålla två informella samrådsmöten som ska vara öppna för alla FN:s medlemsstater så att alla stater kan medverka i samrådsprocessen kring FMCT-processen. Arbetet i den förberedande gruppen väntas leda till förhandlingar om denna viktiga fråga i syfte att ytterligare främja kärnvapennedrustning och icke-spridning.

(7)

Samtliga EU-medlemsstater röstade för FN:s generalförsamlings resolution 71/259 om FMCT från 2016, som lades fram av Kanada, Tyskland och Nederländerna. I resolutionen föreskrivs en inkluderande samrådsprocess som ska äga rum genom att informella samrådsmöten anordnas med alla FN:s medlemsstater och ordförandenför den förberedande expertgruppen på hög nivå för FMCT. Flera EU-medlemsstater kommer att delta i arbetet inom den förberedande expertgruppen på hög nivå, vars uppdrag är att utarbeta rekommendationer om väsentliga inslag i ett framtida fördrag, utan att detta påverkar medlemsstaternas ståndpunkter i framtida förhandlingar.

(8)

Den förberedande expertgruppen på hög nivå för FMCT kommer att utgöra ett konkret bidrag till kärnvapennedrustning och icke-spridning. Gruppen av statliga experter (1) och två rapporter från generalsekreteraren i detta ärende (2) har konstaterat ärendets komplexa karaktär samt tagit upp frågor som kräver ytterligare analys och behandling av FN:s medlemsstater. Den förberedande expertgruppen på hög nivå för FMCT kommer att rapportera till FN:s generalförsamling vid dess 73: e session (2018).

(9)

Mer generellt är klyvbart material (exempelvis anrikat uran eller plutonium), som kan leda till en explosiv kedjereaktion av kärnklyvningar, en viktig beståndsdel i kärnvapen. Ett omedelbart inledande och ett snabbt slutförande av förhandlingarna inom ramen för nedrustningskonferensen om ett fördrag om förbud mot framställning av klyvbart material för kärnvapen och andra kärnladdningar har länge varit en av EU:s prioriteringar.

(10)

Ett fördrag om förbud mot framställning av klyvbart material för kärnvapen och andra kärnladdningar skulle utgöra ett viktigt steg mot att skapa förutsättningar för en värld utan kärnvapen. FMCT anses vara ett multilateralt instrument som ska förhandlas fram på kärnvapennedrustningsområdet, som komplement till fördraget om förhindrande av spridning av kärnvapen och fördraget om fullständigt förbud mot kärnsprängningar.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

1.   I enlighet med EU:s strategi, som har som mål att upprätthålla, genomföra och stärka de multilaterala fördragen och avtalen om nedrustning och icke-spridning, ska unionen tillhandahålla stöd till stater i Afrika, Asien-Stillahavsområdet samt Latinamerika och Västindien för att delta i en samrådsprocess i den förberedande expertgruppen på hög nivå för fördraget om förbud mot framställning av klyvbart material för kärnvapen.

2.   De projekt som ger stöd till stater i Afrika, Asien-Stillahavsområdet och Latinamerika och Västindien att delta i ett samråd i den förberedande gruppen på hög nivå för FMCT, och som motsvarar åtgärder i linje med EU-strategin, ska bestå av subregionala workshoppar, expertmöten och omfattande stödverksamhet till FN:s medlemsstater samt inrättande av en resurs med relevant information och publikationer.

3.   Projekten har följande målsättningar:

Underlättande av dialog på regional nivå mellan stater i regionerna Afrika, Asien-Stillahavsområdet samt Latinamerika och Västindien.

Utveckling av en känsla av egenansvar i frågan bland alla stater i dessa regioner.

Kartläggning av nationella behov och politiska prioriteringar för staterna i dessa regioner.

Medverkan av relevanta regionala organisationer i diskussionerna om ett fördrag om förbud mot framställning av klyvbart material för tillverkning av kärnvapen och andra kärnladdningar, som ska förhandlas inom ramen för nedrustningskonferensen.

Utvärdering av processens konsekvenser på regional nivå och av den roll som relevanta regionala och internationella organisationer kan ha i den processen.

Jämförande analys av processens konsekvenser för varje region.

Underlättande av kunskapsöverföring mellan den akademiska världen, det civila samhällets organisationer och medlemsstaterna i frågan om klyvbart material.

4.   En utförlig beskrivning av projekten återfinns i bilagan.

Artikel 2

1.   Den höga representanten ska ansvara för genomförandet av detta beslut.

2.   Det tekniska genomförandet av de projekt som avses i artikel 1.2 ska genomföras av FN:s kontor för nedrustningsfrågor (Unoda) i Genève och dess regionala nedrustningsavdelning, de tre regionala centrumen för fred och nedrustning i Afrika (UNREC), i Asien och i Stillahavsområdet (UNRCPD) och i Latinamerika och Västindien (UNLIREC). Unoda ska utföra denna uppgift på den höga representantens ansvar. Den höga representanten ska i detta syfte ingå nödvändiga överenskommelser med Unoda.

Artikel 3

1.   Det finansiella referensbeloppet för genomförandet av de projekt som anges i artikel 1.2 ska vara 1 220 880,51 EUR.

2.   De utgifter som finansieras med det belopp som anges i punkt 1 ska förvaltas i enlighet med de förfaranden och regler som är tillämpliga på unionens allmänna budget.

3.   Kommissionen ska övervaka att det bidrag som avses i punkt 1 förvaltas korrekt. Efter antagandet av detta rådsbeslut ska den därför ingå en finansieringsöverenskommelse med Unoda om referensbeloppet. I överenskommelsen ska det fastställas att Unoda ska säkerställa att unionens bidrag synliggörs i proportion till dess storlek.

4.   Kommissionen ska sträva efter att ingå den finansieringsöverenskommelse som avses i punkt 3 snarast möjligt efter det att detta beslut har trätt i kraft. Den ska informera rådet om eventuella svårigheter i samband med detta och om datumet för finansieringsöverenskommelsens ingående.

Artikel 4

1.   Den höga representanten ska rapportera till rådet om genomförandet av detta beslut på grundval av regelbundna rapporter från Unoda. Dessa rapporter ska ligga till grund för rådets utvärdering.

2.   Kommissionen ska informera om de finansiella aspekterna av de projekt som avses i artikel 1.2.

Artikel 5

1.   Detta beslut träder i kraft samma dag som det antas.

2.   Detta beslut upphör att gälla 36 månader efter det att den finansieringsöverenskommelse som avses i artikel 3.3 har ingåtts. Det ska dock upphöra att gälla sex månader efter ikraftträdandet, om inte någon finansieringsöverenskommelse har ingåtts vid denna tidpunkt.

Utfärdat i Bryssel den 11 december 2017.

På rådets vägnar

F. MOGHERINI

Ordförande


(1)  A/70/81, rapport från den grupp av statliga experter med uppgift att utarbeta rekommendationer om olika aspekter, som skulle bidra till men inte förhandla om ett fördrag om förbud mot framställning av klyvbart material för tillverkning av kärnvapen och andra kärnladdningar.

(2)  A/68/154, A/68/154/Add.1, A/71/140/Rev.1 och A/71/140/Rev.1/Add.1.


BILAGA

1.   SYFTE

Staterna har behov av att fullt ut förstå följderna av ett framtida fördrag och dess koppling till regionala instrument om kärnvapenfria zoner, fördraget om förhindrande av spridning av kärnvapen och andra instrument i ett tidigt skede i processen. Därför bör det övergripande målet för det nya rådsbeslutet vara att tillhandahålla finansiering för att bygga upp en bred kunskapsbas om ett fördrag om förbud mot framställning av klyvbart material för kärnvapen eller annan explosiv kärnutrustning eller ett fördrag om förbud mot framställning av klyvbart material för kärnvapen (FMCT) inom det internationella samfundet för att se till att FN:s alla medlemsstater har möjlighet att delta fullt ut i samrådsprocessen samt i eventuella framtida förhandlingar om ett sådant fördrag inom ramen för nedrustningskonferensen.

Att engagera FN:s medlemsstater på regional nivå kommer att komplettera de informella samrådsmöten som kommer att hållas av ordföranden för den förberedande expertgruppen på hög nivå för FMCT i New York, och därigenom öka staternas deltagande såväl kvantitativt som kvalitativt och stärka delaktigheten när det gäller framtida förhandlingar om ett sådant fördrag inom ramen för nedrustningskonferensen.

Anordnande av en rad (sub)regionala workshoppar kommer att göra det möjligt att dela information och kunskap inom regioner samt mellan regioner. Workshopparna kommer att omfatta en blandning av tekniska genomgångar och diskussioner om konsekvenserna och relevansen av dessa framtida fördrag för befintliga regionala arrangemang. De tekniska genomgångarna med relevanta experter kommer att gå närmare in på de viktigaste frågorna med anknytning till FMCT, medan diskussionerna kommer att få deltagarna at beakta konsekvenserna och relevansen av ett eventuellt fördrag på regional nivå.

Den förberedande expertgruppen på hög nivå för FMCT kommer att rapportera till FN:s generalförsamling vid dess 73: e session (2018). Generalförsamlingen får besluta att vidta ytterligare åtgärder i denna fråga. I syfte att stödja FN-medlemsstaternas deltagande i diskussionen om denna fråga kommer projektet att fortsätta fram till slutet av den ordinarie sessionen i generalförsamlingens 74: e session (december 2019).

FN:s kontor för nedrustningsfrågor (Unoda) i Genève och dess regionala nedrustningsavdelning, vilket inbegriper Förenta nationernas regionala centrum för fred och nedrustning (UNREC) i Lomé, Togo, Förenta nationernas regionala centrum för fred, nedrustning och utveckling i Asien och Stillahavsområdet (UNRCPD) i Katmandu, Nepal och Förenta nationernas regionala centrum för fred, nedrustning och utveckling i Latinamerika och Västindien (UNLIREC) i Lima, Peru, har alla lång erfarenhet av att stödja stater och främja dialog i sina respektive regioner om kärnvapennedrustning och icke-spridning.

Experter kommer att hämtas från flera länder, utifrån en bred geografisk bas, från regeringar och regionala organisationer samt det civila samhällets organisationer, t.ex. den internationella panelen för klyvbara ämnen (IPFM), Vertic, Institutet för säkerhetsstudier och den akademiska världen.

I FN:s mål för hållbar utveckling noteras i mål 16.8 behovet av att bredda och förstärka utvecklingsländernas deltagande i institutionerna för global styrning. De verksamheter som planeras inom ramen för detta projekt skulle därför kunna bidra till detta mål.

2.   VERKSAMHETER

2.1   Verksamheternas mål

Underlätta dialog på regional och subregional nivå mellan stater i regionerna Afrika, Asien-Stillahavsområdet samt Latinamerika och Västindien

Engagera relevanta regionala organisationer i diskussionerna om FMCT

Skapa en känsla av egenansvar för framtida FMCT bland alla medlemsstater

Underlätta överföring och tillämpning av kunskap mellan den akademiska världen, det civila samhällets organisationer och medlemsstaterna om frågor som rör förbud mot framställning av klyvbart material för kärnvapen och andra kärnladdningar.

2.2   Verksamhetsbeskrivning

Alla verksamheter kommer att anordnas av Unoda, genom dess kontor i Genève och dess regionala nedrustningsavdelning, vilket inbegriper UNREC, med säte i Lomé, Togo, UNRCPD, med säte i Katmandu, Nepal och UNLIREC, med säte i Lima, Peru.

a)

Subregionala workshoppar i Afrika, Asien och Stillahavsområdet samt Latinamerika och Västindien

Unoda kommer att organisera upp till sex subregionala seminarier i regionerna Afrika, Asien och Stillahavsområdet samt Latinamerika och Västindien. Unoda kommer att organisera upp till två stycken två dagar långa subregionala workshoppar i Afrika, Asien-Stillahavsområdet och Latinamerika och Västindien. De subregionala seminarierna kommer att inrikta sig på deras respektive regioner.

Seminarierna kommer att inbegripa experter från huvudstäderna i länderna i respektive underregion liksom den förberedande gruppen på hög nivå för FMCT, experter från Europeiska unionen och från det civila samhället och den akademiska världen.

Dessa seminarier kommer att komplettera de öppna informella samrådsmöten som leds av ordföranden för den förberedande gruppen på hög nivå för FMCT i New York i enlighet med FN:s generalförsamlings resolution 71/259 och kommer att underlätta för experter från FN:s medlemsstater att delta vid huvudsätet i framtidens förhandlingar om FMCT.

b)

Möten med experter från regionala organisationer

Unoda kommer att organisera tre expertmöten med relevanta regionala organisationer i regionerna Afrika, Asien och Stillahavsområdet samt Latinamerika och Västindien, däribland argentinsk-brasilianska atomenergiorganet (ABACC), AFCONE, OPANAL och Aseans regionala forum (ARF) för att sammanföra medlemmar i den förberedande gruppen på hög nivå för FMCT, experter från regionala organisationer och experter från det civila samhällets organisationer, däribland EU-konsortiet för icke-spridning, Vertic, IPFM, Institutet för säkerhetsstudier för att förbereda framtida förhandlingar om FMCT och främja bidrag från regionala experter och erfarenheter till dessa förhandlingar.

c)

Betydande stöd till medlemsstaterna

Unoda kommer att svara på upp till sex ansökningar om betydande stöd från staterna i regionerna Afrika, Asien och Stillahavsområdet samt Latinamerika och Västindien som uppföljning på seminarier, med beaktande av den geografiska balansen.

d)

Förvaring av resursmaterial och offentliggörande av resultat

Unoda kommer under hela projektet att utveckla och underhålla en särskild webbplats med relevant resursmaterial för att hjälpa staterna att förbereda sig för det framtida FMCT och fungera som en resurs för stater, regionala organisationer, det civila samhällets organisationer och forskare samt underlätta gränsöverskridande kommunikation.

Unoda kommer att offentliggöra två Unoda Occasional Papers om resultaten av de regionala seminarierna och expertmötena med regionala organisationer.

2.3   Effekterna av verksamheten

Deltagandet av stater i regionerna Afrika, Asien, Stilla havet, Latinamerika och Västindien i framtida förhandlingar om FMCT kommer att underlättas

Befintlig regional kunskap och expertis om förbud mot framställning av klyvbart material för tillverkning av kärnvapen och andra kärnladdningar tas med till förhandlingarna om ett framtida FMCT

Relevant resursmaterial görs tillgängligt för framtida förhandlare och för experter från medlemsstaterna, regionala organisationer, det civila samhället och den akademiska världen.

3.   PARTNER I ÅTGÄRDERNA

FN-systemet: Unoda, via dess kontor i Genève och dess regionala nedrustningsavdelning, vilket inbegriper de tre regionala centrumen för fred och nedrustning i Afrika (UNREC), i Asien och Stillahavsområdet (UNRCPD) och i Latinamerika och Västindien (UNLIREC)

Regionala och subregionala organisationer: argentinsk-brasilianska atomenergiorganet (ABACC), AFCONE, OPANAL, Aseans regionala forum (ARF)

Icke-statliga organisationer: EU-konsortiet för icke-spridning, Vertic, IPFM, Institutet för säkerhetsstudier.

4.   INTERAKTION MED UNIONSINSATSER

Mot bakgrund av regelbunden återkoppling från Unoda om dess verksamhet får unionen besluta att komplettera dessa insatser genom riktade diplomatiska åtgärder som syftar till att öka medvetenheten om hur viktigt det är att övervinna det långvariga dödläget i nedrustningskonferensen och omedelbart inleda och snabbt slutföra förhandlingarna inom ramen för nedrustningskonferensen om ett fördrag om förbud mot framställning av klyvbart material för tillverkning av kärnvapen och andra kärnladdningar (FMCT), på grundval av dokument CD/1299 och mandatet i detta.

5.   MOTTAGARE AV VERKSAMHETEN

Stater i regionerna Afrika, Asien-Stillahavsområdet samt Latinamerika och Västindien

medlemmar av den förberedande gruppen på hög nivå för FMCT

gruppen av statliga experter för kontroll av kärnvapennedrustning

det civila samhällets organisationer i regionerna Afrika, Asien-Stillahavsområdet och Latinamerika och Västindien om kärnvapennedrustning och icke-spridning.

6.   PLATS

De subregionala seminarierna kommer att anordnas antingen på de regionala centrumen eller på något av FN:s regionalkontor i respektive subregion, för att underlätta för nationella experter från huvudstäderna att delta.

Expertmöten kommer att hållas där de regionala organisationerna eller de regionala centrumen är belägna.

Betydande stöd till medlemsstaterna kommer att tillhandahållas i huvudstäderna.

7.   VARAKTIGHET

Projektets totala uppskattade varaktighet är 36 månader.


12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/38


KOMMISSIONENS BESLUT (EU) 2017/2285

av den 6 december 2017

om ändring av användarhandledningen om hur man ska gå till väga för att delta i Emas i enlighet med Europaparlamentets och rådets förordning (EG) nr 1221/2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning (Emas)

[delgivet med nr C(2017) 8072]

(Text av betydelse för EES)

EUROPEISKA KOMMISSIONEN HAR ANTAGIT DETTA BESLUT

med beaktande av fördraget om Europeiska unionens funktionssätt,

med beaktande av Europaparlamentets och rådets förordning (EG) nr 1221/2009 av den 25 november 2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning (Emas) och om upphävande av förordning (EG) nr 761/2001 och kommissionens beslut 2001/681/EG och 2006/193/EG (1), särskilt artikel 46.5, och

av följande skäl:

(1)

Emas har till syfte att främja en ständig förbättring av organisationers miljöprestanda genom införande och tillämpning av ett miljöledningssystem, utvärdering av detta systems prestanda, tillhandahållande av information om miljöprestanda, en öppen dialog med allmänheten och andra intressenter och ett aktivt engagemang hos de anställda.

(2)

Intresserade organisationer bör få mer information och vägledning om hur de ska gå till väga för att delta i Emas. Denna information och vägledning ska hållas uppdaterad på grundval av de erfarenheter som erhålls vid tillämpningen av Emas och för att tillgodose ytterligare behov av vägledning.

(3)

Följande ytterligare behov av vägledning har identifierats: definition av geografisk plats i definitionen av en anläggning, vägledning om hur de sektorspecifika referensdokumenten bör beaktas och vägledning om användningen av en urvalsmetod för kontroll av organisationer med flera anläggningar.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

Bilagan till kommissionens beslut 2013/131/EU (2) ska ersättas med texten i bilagan till det här beslutet.

Artikel 2

Detta beslut riktar sig till medlemsstaterna.

Utfärdat i Bryssel den 6 december 2017.

På kommissionens vägnar

Karmenu VELLA

Ledamot av kommissionen


(1)  EUT L 342, 22.12.2009, s. 1.

(2)  Kommissionens beslut 2013/131/EU av den 4 mars 2013 om upprättande av en användarhandledning om hur man ska gå till väga för att delta i Emas i enlighet med Europaparlamentets och rådets förordning (EG) nr 1221/2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning (Emas) (EUT L 76, 19.3.2013, s. 1).


BILAGA

BILAGA I

I.   INLEDNING

Ett av målen med EU:s miljöpolitik är att uppmuntra alla typer av organisationer att använda miljöledningssystem och minska sin miljöpåverkan. Miljöledningssystem är ett av de verktyg som företag och andra organisationer kan använda för att förbättra sin miljöprestanda och samtidigt spara energi och andra resurser. EU vill framför allt uppmuntra organisationer att delta i gemenskapens miljölednings- och miljörevisionsordning (Emas), som är ett ledningsverktyg som företag och andra organisationer kan använda för att utvärdera, rapportera och förbättra sin miljöprestanda.

Emas inrättades 1993 och har utvecklats med tiden. Emas-förordningen (1) utgör den rättsliga grunden för ordningen och omarbetades senast 2009.

Denna användarhandledning för Emas har utarbetats i enlighet med artikel 46.5 i Emas-förordningen. Syftet med dokumentet är att ge tydliga, enkla råd till organisationer som är intresserade av Emas. Tanken är att ge steg för steg-anvisningar som är enkla att följa. Handledningen innehåller de huvudsakliga punkterna i Emas och de steg som ska tas av organisationer som vill delta i ordningen. Tanken med dokumentet är att göra det lättare för organisationer att delta i Emas miljöledningssystem och därmed få fler att delta i ordningen. Det är även viktigt att komma ihåg att det övergripande syftet med förordningen är att harmonisera genomförandet i alla medlemsstater och upprätta en gemensam rättslig ram. När det gäller frågor om global Emas-registrering hänvisas till kommissionens beslut 2011/832/EU (2) av den 7 december 2011 om en handledning för företagsregistrering i EU och tredjeland samt global registrering enligt förordning (EG) nr 1221/2009.

II.   VAD ÄR MILJÖLEDNINGS- OCH MILJÖREVISIONSORDNINGEN (EMAS)?

Emas är ett frivilligt verktyg för alla organisationer inom alla ekonomiska sektorer inom eller utanför EU som vill

ta ett miljömässigt och ekonomiskt ansvar,

förbättra sin miljöprestanda,

förmedla sina resultat på miljöområdet till samhället och berörda parter i allmänhet.

Nedan följer en beskrivning steg för steg av vad man behöver göra för att registrera sig och genomföra ordningen.

Organisationer som registrerar sig i Emas måste

visa att de uppfyller miljölagstiftningen,

åta sig att ständigt förbättra sin miljöprestanda,

visa att de har en öppen dialog med alla berörda parter,

se till att arbetstagarna deltar i arbetet med att förbättra organisationens miljöprestanda,

offentliggöra och uppdatera en godkänd miljöredovisning enligt Emas för extern kommunikation.

Det finns ytterligare några krav. Organisationerna måste

göra en miljöutredning (och då bland annat identifiera alla direkta och indirekta miljöaspekter),

registrera sig hos ett behörigt organ när organisationen har kontrollerats och godkänts.

När organisationen har registrerats har den rätt att använda Emas-logotypen.

III.   KOSTNADER OCH FÖRDELAR MED ATT GENOMFÖRA EMAS

I allmänhet hjälper miljöledningssystem som Emas organisationer att öka sin resurseffektivitet, minska riskerna och föregå med gott exempel med sin offentliga försäkran om god praxis. Kostnaderna för att genomföra en sådan ordning uppvägs av besparingarna.

Fördelar

En studie (3) om kostnader och fördelar förenade med att registrera sig i Emas har genomförts. I en undersökning ombads deltagarna att ange de största fördelarna med registreringen utifrån en lista med alternativ. ”Energi- och resursbesparingar” hamnade i topp (21 %), vilket framgår av figur 1. Detta följdes av ”färre negativa incidenter” (18 %) och ”bättre relationer med berörda parter” (17 %).

Figur 1

Fördelar med att genomföra Emas (% av alla svar)

Image

Besparingar till följd av ökad effektivitet

”Energi- och resursbesparingar” var den fördel som rankades högst. Undersökningen visade att energibesparingarna i sig översteg de årliga kostnaderna för att underhålla Emas för organisationer av alla storlekar. Detta tyder på att större organisationer lätt skulle kunna få tillbaka kostnaderna för att genomföra Emas.

Färre negativa incidenter

Denna fördel rankades som nummer två. Flera faktorer, till exempel färre överträdelser av miljölagstiftningen, spelade in. Detta hänger uppenbarligen ihop med fördelarna i form av bättre relationer med tillsynsmyndigheterna.

Bättre relationer med berörda parter

Organisationerna ansåg att relationerna med berörda parter var en viktig fördel, särskilt när det gäller offentlig förvaltning och tjänsteföretag.

Fler marknadsmöjligheter

Registrering i Emas kan vara fördelaktigt för affärerna. Den kan bidra till att behålla befintliga kunder och leda till nya affärsmöjligheter. Vid offentlig upphandling kan det vara en fördel att ha ett Emas-miljöledningssystem. Även om organisationer som deltar i offentliga upphandlingar inte uttryckligen kan kräva att anbudsgivarna är registrerade i Emas kan företag som är registrerade använda detta för att visa att de har de tekniska förutsättningarna att uppfylla miljöledningskraven.

Dessutom kan organisationerna uppmuntra sina leverantörer att ha ett miljöledningssystem som en del av sin miljöpolicy. Att vara registrerad i Emas kan göra de interna förfarandena mellan företag lättare för båda parter.

Regellättnader

Emas-registrerade organisationer kan ha rätt till regellättnader. Det kan finnas fördelar för företag i tillverkningssektorn enligt direktivet om samordnade åtgärder för att förebygga och begränsa föroreningar (4).

Flera medlemsstater ger även fördelar till organisationer som är registrerade i Emas när det gäller nationella och regionala lagar och förordningar på miljöområdet. Dessa fördelar kan till exempel innebära förenklade rapporteringskrav, färre inspektioner, lägre avfallsavgifter och längre intervaller mellan tillståndsförnyelser

Det kan till exempel röra sig om en minskning av avfallsavgifterna med 50 %, en minskning av avgifterna för licensieringsförfaranden med 20–30 %, en minskning av avgifterna för övervakning och tillsyn enligt nationell lagstiftning med upp till 100 %, en minskning av avgifterna för offentliga tjänster som utförs av statliga myndigheter med 30 %, eller en minskning av avgifterna för licensieringsförfaranden för ytvatten, avgifterna för tillstånd för uttag av grundvatten och avgifterna för licensieringsförfaranden för avfallsupplag med 30 %. Det finns även fördelar i samband med administreringen av övervakning och hantering av farliga kemikalier, avfallshanteringskrav (belägg för tekniska övervakningsåtgärder krävs ej) och övervakning av växthusgaser.

Kostnader och fördelar

Företagen bör se Emas-registreringen som en investering. Att genomföra Emas är förenat med både interna och externa kostnader, till exempel för konsulthjälp, personal för att genomföra och följa upp åtgärder, inspektioner, registreringsavgifter osv.

De faktiska kostnaderna och fördelarna varierar kraftigt, till exempel beroende på organisationens storlek och verksamhet, nuvarande miljöledningspraxis, vilket land det rör sig om osv. I allmänhet leder Emas dock till betydande besparingar. Olika studier har visat att organisationer får tillbaka kostnaderna för genomförandet i form av ökade intäkter relativt snart, oftast inom ett till två år (5)  (6)  (7)  (8)  (9).

Tabell 1

Kostnader och potentiella årliga besparingar till följd av ökad effektivitet med Emas  (10)

(euro)

Organisationsstorlek (11)

Potentiella besparingar till följd av ökad effektivitet

Kostnader för att genomföra Emas under första året (12)

Årliga kostnader för Emas (13)

Mikroorganisationer

3 000 –10 000

22 500

10 000

Små organisationer

20 000 –40 000

38 000

22 000

Medelstora organisationer

Upp till 100 000

40 000

17 000

Stora organisationer

Upp till 400 000

67 000

39 000

Uppgifterna om ”potentiella årliga besparingar till följd av ökad effektivitet” baseras enbart på energibesparingar. Det finns inga uppgifter om besparingar till följd av resurseffektivisering.

 

 

Källa: Costs and Benefits of EMAS to Registered Organisations, studie på uppdrag av Europeiska kommissionen, 2009.

I Emas verktygslåda för små organisationer (14) ges många andra exempel på kostnader/fördelar.

På det hela taget har mikroorganisationer och små organisationer proportionellt sett högre fasta och externa kostnader än medelstora eller stora organisationer, eftersom de senare kan utnyttja stordriftsfördelar, där en högre andel av kostnaderna täcks internt av miljöavdelningar, och har lägre externa kostnader eftersom de inte har lika stort behov av konsulter. Även mycket stora organisationer rekommenderas dock att i detalj undersöka kostnaderna för genomförandet.

Emas har ganska stora likheter med energiförvaltningssystem såsom EN 16001 och ISO 50001. Eftersom energiförvaltning ingår i Emas har Emas-registrerade organisationer redan förbättrat sin energieffektivitet, och uppfyller därmed de flesta kraven i EN 16001 och ISO 50001. Detta kan därför också leda till minskade kostnader.

Organisationer som överväger att registrera sig i Emas bör även beakta det tekniska och finansiella stöd eller de subventioner som medlemsstater, nationella, regionala eller lokala myndigheter och Emas behöriga organ erbjuder.

IV.   EMAS-FÖRORDNINGEN

Emas-ordningen inrättades genom förordning (EG) nr 1221/2009 (även kallad Emas III) och är direkt tillämplig i alla medlemsstater.

1.   ALLMÄNT

1.1   TILLÄMPNINGSOMRÅDE

Sedan 2001 kan alla offentliga eller privata organisationer genomföra Emas. Sedan Emas III infördes är ordningen även öppen för utomeuropeiska organisationer eller europeiska företag som är verksamma i utomeuropeiska länder. I det senare fallet finns det en särskild vägledning om företagsregistrering i EU, i tredjeland och global registrering.

Organisation: företag, bolag, firma, rörelse, myndighet eller institution, med säte inom eller utanför gemenskapen, eller en del av eller en kombination av dessa, oavsett om de är juridiska personer eller ej, offentliga eller privata, som har sina egna funktioner och sin egen administration.

Emas kan genomföras på en, flera eller samtliga anläggningar som tillhör privata eller offentliga organisationer inom alla verksamhetsområden (15). En anläggning är den minsta enhet som kan registreras.

Anläggning: en bestämd geografisk plats som står under en organisations kontroll och som omfattar verksamhet, produkter och tjänster, inklusive all infrastruktur, utrustning och material; en anläggning är den minsta enhet som kan vara föremål för registrering.’

En bestämd geografisk plats bör tolkas på följande sätt:

En fysisk kontinuitet av mark, byggnader, utrustning eller infrastruktur, eventuellt avbruten av externa element under förutsättning att den funktionella och organisatoriska kontinuiteten i verksamheten är garanterad.

1.2   KRAV

Det allmänna förfarandet för att genomföra Emas kan sammanfattas enligt följande:

1.

Organisationen bör börja med att göra en miljöutredning, en inledande analys av hela organisationens verksamhet, för att fastställa relevanta direkta och indirekta miljöaspekter, samt tillämplig miljölagstiftning.

2.

Därefter måste organisationen genomföra ett miljöledningssystem i enlighet med kraven i EN ISO 14001 (bilaga II till Emas-förordningen).

3.

Systemet måste följas upp genom interna revisioner och en genomgång av ledningen.

4.

Organisationen upprättar en miljöredovisning enligt Emas.

5.

Miljöutredningen och miljöledningssystemet kontrolleras och miljöredovisningen godkänns av en ackrediterad eller licensierad Emas-kontrollant.

6.

När organisationen har godkänts lämnar den in en ansökan om registrering till det behöriga organet.

I enlighet med artikel 46 i Emas-förordningen håller kommissionen på att utarbeta ”sektorspecifika referensdokument” (16) för ett antal prioriterade sektorer i samråd med medlemsstaterna och andra berörda parter.

Varje dokument innehåller följande delar:

Bästa miljöledningspraxis.

Miljöprestandaindikatorer för de berörda specifika sektorerna.

Vid behov riktmärken för resultat i världsklass och poängsystem för att ange miljöprestandanivåer.

Emas-registrerade organisationer ska beakta relevanta sektorspecifika referensdokument på två olika nivåer:

1.

När de utvecklar och genomför sitt miljöledningssystem mot bakgrund av miljöutredningarna (artikel 4.1 b).

2.

När de utarbetar miljöredovisningen (artikel 4.1 d och 4.4).

Emas-deltagande är en pågående process. Varje gång en organisation ser över sin miljöprestanda och planerar förbättringar ska den ta hjälp av det sektorspecifika referensdokumentet (om ett sådant finns) på särskilda områden för att komma fram till vilka problem som ska tacklas härnäst i en stegvis strategi.

Figur 2

Generell tidsplan för genomförandet av Emas

Image

Tabell 2

Preliminär tidsplan för genomförandet av Emas. Den angivna tiden för varje åtgärd är genomsnittlig och kan vara kortare eller längre beroende på vilken medlemsstat det rör sig om, organisationens storlek osv.

Emas

Månad 1

Månad 2

Månad 3

Månad 4

Månad 5

Månad 6

Månad 7

Månad 8

Månad 9

Månad 10

Miljöutredning

X

X

 

 

 

 

 

 

 

 

Miljöledningssystem

 

X

X

X

X

X

X

 

 

 

Generella krav

 

X

 

 

 

 

 

 

 

 

Miljöpolicy

 

X

 

 

 

 

 

 

 

 

Planering: Övergripande och detaljerade miljömål

 

X

 

 

 

 

 

 

 

 

Planering: Miljöprogram

 

 

X

X

X

 

 

 

 

 

Införande och tillämpning: Resurser, roller, ansvar och befogenheter

 

 

 

 

X

 

 

 

 

 

Införande och tillämpning: Personalens kompetens, utbildning och medvetenhet samt arbetstagarnas delaktighet

 

 

 

 

X

 

 

 

 

 

Införande och tillämpning: Kommunikation (intern och extern)

 

 

 

 

 

X

 

 

 

 

Införande och tillämpning: Dokumentation och dokumentstyrning

 

X

X

X

X

X

 

 

 

 

Införande och tillämpning: Verksamhetsstyrning

 

 

 

 

 

X

X

 

 

 

Införande och tillämpning: Beredskapsplaner

 

 

 

 

 

 

X

 

 

 

Uppföljning: Övervakning och mätning, utvärdering av att lagstadgade krav och andra krav följs, avvikelse, korrigerande och förebyggande åtgärder samt redovisande dokument

 

 

 

 

X

X

X

 

 

 

Uppföljning: Intern revision

 

 

 

 

 

 

X

X

 

 

Ledningens genomgång

 

 

 

 

 

 

 

X

 

 

Emas-miljöredovisning

 

 

 

 

 

 

 

 

X

 

Kontroll och godkännande

 

 

 

 

 

 

 

 

X

 

Registrering

 

 

 

 

 

 

 

 

 

X

2.   HUR EMAS GENOMFÖRS

2.1   MILJÖUTREDNING

Första steget för att genomföra Emas är att göra en grundlig analys av organisationens interna struktur och verksamhet. Syftet är att fastställa miljöaspekter (definieras nedan) som hänger samman med miljöpåverkan. Detta är grunden i arbetet med att upprätta ett formellt miljöledningssystem.

Miljöutredning: en inledande heltäckande analys av de miljöaspekter, den miljöpåverkan och den miljöprestanda som är förknippad med organisationens verksamhet, produkter och tjänster.

Analysen måste innehålla följande:

Lagstadgade krav som gäller för organisationen.

Fastställande av direkta och indirekta miljöaspekter.

Kriterier för att bedöma miljöaspekternas betydelse.

Undersökning av alla befintliga miljöledningsrutiner och -förfaranden.

Utvärdering av återkoppling från undersökningar av tidigare tillbud.

Miljöaspekt: en del av en organisations verksamhet, produkter eller tjänster som påverkar eller kan påverka miljön. Miljöaspekter kan vara insatsrelaterade (till exempel förbrukning av råvaror och energi) eller resultatrelaterade (utsläpp i luften, avfallsproduktion osv.).

Figur 3

Förhållandet mellan verksamheter, miljöaspekter och miljöpåverkan

Image

Organisationen behöver rutiner för att se till att verksamheter som vid den första miljöutredningen konstaterats ha betydande miljöpåverkan följs upp senare. Miljöaspekter och därmed förenad miljöpåverkan kan ändras, liksom organisationens verksamhet. Om ändringarna är väsentliga kan miljöutredningen behöva uppdateras. En organisation bör även vara medveten om nya händelser, metoder, forskningsresultat osv. som kan vara till hjälp när den ska göra en ny bedömning av sina miljöaspekter och bedöma om det behövs en ny miljöutredning om organisationens verksamhet ändras väsentligt.

Hur genomförs en miljöutredning?

Organisationen måste

identifiera miljöaspekter som härrör från organisationens tillverkningsprocess, verksamhet eller tjänster, och

fastställa kriterier för att bedöma aspekternas betydelse. Kriterierna måste vara heltäckande och måste kunna vara föremål för oberoende kontroll.

Organisationen bör komma ihåg att den måste redovisa de miljöaspekter som den identifierar och resultaten av utvärderingen för externa berörda parter.

Hur identifieras miljöaspekterna?

Organisationen måste samla in all relevant information.

Detta kan innebära följande:

Besöka anläggningar för att följa upp förfarandenas insatser och resultat (och vid behov göra anteckningar eller ritningar).

Samla in kartor och bilder över platsen.

Identifiera tillämplig miljölagstiftning.

Samla in alla miljötillstånd, licenser och liknande dokument.

Kontrollera alla informationskällor (inkommande fakturor, mätare, uppgifter om utrustning osv.).

Kontrollera användningen av produkter (ofta är inköps- och säljavdelningarna en lämplig utgångspunkt).

Identifiera centrala personer (ledningspersoner och arbetstagare). Be arbetstagare inom alla interna system att komma med synpunkter.

Be att få information av underleverantörer som kan ha ett väsentligt inflytande på en organisations miljöprestanda.

Ta hänsyn till tidigare tillbud samt resultatet av övervakning och tillsyn.

Identifiera situationer vid igångsättning och stängning och identifierade risker.

Organisationen måste ta hänsyn till både direkta och indirekta miljöaspekter, och definitionerna nedan bör vara till hjälp för att identifiera dessa:

 

Direkt miljöaspekt: en miljöaspekt som är förknippad med en organisations verksamhet, produkter och tjänster och som den har direkt ledningskontroll över.

 

Indirekt miljöaspekt: en miljöaspekt som kan följa av en organisations samverkan med tredje part och som i rimlig grad kan påverkas av organisationen.

Det är viktigt att ta hänsyn till indirekta aspekter. Detta gäller både den privata och offentliga sektorn, vilket innebär att till exempel lokala myndigheter, tjänsteföretag och finansinstitut vid miljöutredningen måste ta hänsyn till aspekter även utanför anläggningen.

Organisationen måste kunna visa att den har identifierat betydande miljöaspekter förenade med sina upphandlingsförfaranden och att den i sitt ledningssystem har tagit itu med betydande miljöpåverkan förenad med dessa.

Tabell 3

Exempel på direkta och indirekta aspekter

Miljöaspekter

Direkta aspekter

Indirekta aspekter

Utsläpp i luften

Utsläpp i vatten

Avfall

Användningen av naturresurser och råvaror

Lokala frågor (buller, vibrationer, lukt)

Markanvändning

Utsläpp i luften i samband med transport

Risk för miljöolyckor och nödsituationer

Frågor som rör produktlivslängd

Kapitalinvesteringar

Försäkringsverksamhet

Administrativa och planeringsmässiga beslut

Entreprenörers, underleverantörers och leverantörers miljöprestanda

Val av tjänster och deras sammansättning, t.ex. transport eller catering

Direkta miljöaspekter måste omfatta tillhörande lagstadgade krav och tillståndsbegränsningar, och om det t.ex. finns utsläppsgränsvärden eller andra krav för specifika föroreningar så bör dessa utsläpp betraktas som direkta miljöaspekter.

Bedömning av miljöaspekter

Nästa steg är att koppla samman miljöaspekterna med deras miljöpåverkan. I tabell 4 ges ett exempel på sådana kopplingar.

Tabell 4

Exempel på miljöaspekter och miljöpåverkan

Verksamhet

Miljöaspekt

Miljöpåverkan

Transport

Använda maskinoljor

Koldioxidutsläpp från lastbilar och maskiner

Jord-, vatten- och luftföroreningar

Växthuseffekten

Bygg

Utsläpp i luften, buller, vibrationer osv. från byggmaskiner

Markanvändning

Buller samt jord-, vatten- och luftföroreningar

Förstörelse av marktäcket

Förlust av biologisk mångfald

Kontorstjänster

Användning av material som papper, toner osv.

Elförbrukning (som indirekt leder till koldioxidutsläpp)

Föroreningar i form av blandat kommunalt avfall

Växthuseffekten

Kemisk industri

Avloppsvatten

Utsläpp av flyktiga organiska föreningar

Utsläpp av ämnen som bryter ned ozonskiktet

Vattenföroreningar

Fotokemiskt ozon

Nedbrytning av ozonlagret

När miljöaspekterna och deras miljöpåverkan har identifierats är nästa steg att göra en detaljerad bedömning av respektive aspekt för att se om det finns betydande miljöaspekter.

Betydande miljöaspekt: en miljöaspekt som har eller kan ha en betydande miljöpåverkan.

Organisationen bör ta ställning till följande punkter när den bedömer miljöaspektens betydelse:

i)

Potential att orsaka miljöskada.

ii)

Den lokala, regionala och globala miljöns känslighet.

iii)

Aspektens eller påverkans storlek, antal, frekvens och reversibilitet.

iv)

Förekomsten av och kraven i relevant miljölagstiftning.

v)

Betydelse för intressenter och organisationens anställda.

Baserat på dessa kriterier kan organisationen upprätta ett internt förfarande eller använda andra verktyg för att bedöma miljöaspekternas betydelse. Det finns mycket användbar information i Emas verktygslåda för små och medelstora företag (17).

Vid bedömningen av miljöaspekternas betydelse är det viktigt att inte bara ta hänsyn till normala driftsförhållanden utan även förhållanden under igångsättning och stängning samt vid nödsituationer. Hänsyn ska tas till tidigare, nuvarande och planerade verksamheter.

För varje miljöaspekt ska motsvarande miljöpåverkan bedömas utifrån följande:

Omfattning – utsläppsnivåer, energi- och vattenförbrukning osv.

Allvarlighetsgrad – faror, giftighet osv.

Frekvens/sannolikhet.

Berörda parters farhågor.

Lagstadgade krav.

Tabell 5

Bedömning av miljöaspekter

Bedömningskriterier

Exempel

Vilka av organisationens resultat eller verksamheter kan påverka miljön negativt?

Avfall: blandat kommunalt avfall, förpackningsavfall, farligt avfall

Omfattningen av aspekter som kan påverka miljön

Mängden avfall: stor, medelstor, liten

Allvarlighetsgraden av aspekter som kan påverka miljön

Avfallets farlighetsgrad, materialets giftighet: hög, medelhög, låg

Frekvensen av aspekter som kan påverka miljön

Hög, medelhög, låg

Allmänhetens och arbetstagarnas medvetenhet om aspekter som rör organisationen

Allvarliga, vissa, inga klagomål

Delar av organisationens verksamhet som omfattas av miljölagstiftning

Tillstånd och övervakningskrav enligt avfallslagstiftningen

Anm.: Det är lämpligt att kvantifiera kriterier och vissa aspekters övergripande betydelse.

Hur regelefterlevnaden kontrolleras

Regelefterlevnad: fullständigt uppfyllande av tillämpliga lagstadgade miljökrav, inklusive tillståndsvillkor.

Medlemsstaterna måste se till att organisationer åtminstone har tillgång till information och stöd i följande frågor:

Information om tillämpliga lagstadgade miljökrav.

Information om vilka som är behöriga tillståndsmyndigheter för specifika miljökrav.

Tillsynsmyndigheterna är skyldiga att besvara frågor, åtminstone från små organisationer, om tillämpliga lagstadgade miljökrav och om hur organisationerna kan gå till väga för att uppfylla dessa lagstadgade krav.

För att identifiera alla tillämpliga lagstadgade krav måste man i tillämpliga fall ta hänsyn till miljölagstiftning på olika nivåer, till exempel nationella, regionala eller lokala krav, inklusive tillstånd och licenser.

Organisationen måste även ta hänsyn till andra relevanta krav, till exempel upphandlingsvillkor, affärskontrakt, frivilliga överenskommelser som organisationen har undertecknat eller ingått osv.

Det är viktigt att i det här läget identifiera vilka lagstadgade krav som gäller så att organisationen kan precisera eventuella krav som inte är uppfyllda. Vid behov måste organisationen sedan vidta åtgärder för att uppfylla all relevant miljölagstiftning (se punkt 2.2.5.2 om utvärdering av regelefterlevnad).

2.2   MILJÖLEDNINGSSYSTEM

Miljöledningssystem: den del av det övergripande ledningssystemet som omfattar organisationsstruktur, planering, ansvar, praxis, rutiner, processer och resurser för att utveckla, genomföra, uppfylla, revidera och underhålla miljöpolicyn samt för att hantera miljöaspekter.

2.2.1    Generella krav

Till att börja med måste organisationen definiera och dokumentera miljöledningssystemets tillämpningsområde.

Varje anläggning som ska registreras i Emas måste uppfylla alla krav i Emas-förordningen.

Organisationen måste inrätta, dokumentera, genomföra och underhålla ett miljöledningssystem i enlighet med avsnitt 4 i EN ISO 14001. Om organisationen har genomfört ett miljöledningssystem (utöver ISO 14001) som kommissionen har erkänt (18) behöver den inte upprepa de punkter som redan har blivit officiellt erkända när den ska uppfylla kraven i Emas-förordningen.

2.2.2    Miljöpolicy

Miljöpolicy: en organisations övergripande intentioner och riktlinjer i fråga om miljöprestanda, formellt uttryckt av organisationens högsta ledning […]. Den utgör grunden för åtgärder och fastställande av övergripande och detaljerade miljömål.

Miljöpolicyn måste omfatta följande punkter:

Åtagande att uppfylla lagstadgade och andra krav som kan relateras till organisationens miljöaspekter.

Åtagande att förebygga föroreningar.

Åtagande att ständigt förbättra sin miljöprestanda.

Miljöpolicyn utgör grunden för åtgärder och för fastställande av strategiska övergripande och detaljerade miljömål (se nedan). Den måste vara tydlig och innehålla de främsta prioriteringarna utifrån vilka man sedan kan fastställa specifika övergripande och detaljerade mål.

2.2.3    Planering

När organisationen har klarat av de grundläggande frågor som beskrivs ovan är det dags att gå vidare till planeringen.

2.2.3.1   Övergripande och detaljerade miljömål

Övergripande miljömål: ett övergripande miljömål som följer av miljöpolicyn och som en organisation bestämmer sig för att uppfylla och som är kvantifierat där så är möjligt.

Detaljerat miljömål: ett detaljerat resultatkrav som följer av de övergripande miljömålen, som är tillämpligt på organisationen eller delar därav och som behöver fastställas och uppfyllas för att de övergripande miljömålen ska uppnås.

Organisationen måste upprätta och dokumentera de övergripande och detaljerade målen för varje aspekt som är relevant för organisationen i enlighet med dess miljöpolicy.

När målen har definierats är nästa steg att fastställa konkreta detaljerade mål för dem. Med hjälp av detaljerade mål kan organisationen planera specifika åtgärder som ska genomföras för att uppnå en bra miljöledning.

Figur 4

Förhållandet mellan övergripande mål, detaljerade mål och åtgärder

Image

Exempel:

Övergripande miljömål

Minimera produktionen av farligt avfall

Detaljerat miljömål

Minska användningen av organiska lösningsmedel i processen med 20 % på tre år

Åtgärd

Återanvända lösningsmedel när detta är möjligt

Återvinna organiska lösningsmedel

Övergripande och detaljerade mål bör om möjligt vara mätbara och förenliga med organisationens miljöpolicy. Här är ”SMART-kriterierna” användbara:

Specific (specifika) – varje detaljerat mål bör vara inriktat på en enda fråga.

Measurable (mätbara) – varje detaljerat mål bör uttryckas i kvantitativa termer.

Achievable (nåbara) – de detaljerade målen bör kunna uppnås.

Realistic (realistiska) – de detaljerade målen bör vara krävande och leda till kontinuerliga förbättringar, men inte alltför ambitiösa. De kan alltid ändras när de har uppfyllts.

Time-bound (tidsbegränsade) – det bör finnas en tidsfrist för att uppnå varje mål.

Emas-registrerade organisationer ska beakta de relevanta delarna av de sektorspecifika referensdokument som finns för deras sektor och som avses i artikel 46 i Emas-förordningen. De bör användas vid utarbetandet och översynen av organisationens miljömål och detaljerade mål i enlighet med de relevanta miljöaspekter som har identifierats i miljöutredningen. Det är emellertid inte obligatoriskt att nå riktmärkena för resultat i världsklass, eftersom Emas överlåter till organisationerna själva att bedöma om riktmärkena och tillämpningen av bästa praxis är rimliga för dem med avseende på kostnader och nytta.

2.2.3.2   Miljöprogram

Miljöprogram: en beskrivning av nuvarande eller planerade åtgärder, ansvar och medel för att uppnå övergripande och detaljerade miljömål och tidpunkten för när dessa övergripande och detaljerade miljömål senast ska uppnås.

Miljöprogrammet är ett verktyg för att hjälpa organisationen att planera och genomföra förbättringar från dag till dag. Det bör hållas uppdaterat och tillräckligt detaljerat för att ge en överblick över de framsteg som görs för att uppfylla målen. I programmet bör organisationen specificera vem som är ansvarig för att uppnå de övergripande och detaljerade målen samt ange vilka resurser som krävs och vilka tidsramar som gäller. Resurserna i sig (t.ex. finansiella, tekniska eller personalresurser) får inte räknas som övergripande miljömål.

I praktiken upprättas programmet ofta i tabellform och omfattar följande uppgifter:

Övergripande miljömål, kopplade till direkta och indirekta aspekter.

Specifika detaljerade miljömål för att uppnå de övergripande målen.

Åtgärder, skyldigheter, resurser och tidsramar för varje detaljerat mål:

Beskrivning av åtgärderna.

Person som ansvarar för det detaljerade målet.

Lägesbeskrivning vid genomförandets början.

De resurser som behövs för att uppnå det detaljerade målet.

Övervakningsfrekvens för att uppnå målet.

Slutresultat som ska uppnås, inklusive tidsfrist.

Ovanstående förfarande måste dokumenteras.

Både direkta och indirekta aspekter bör beaktas vid upprättandet av programmet. Organisationen bör åta sig att kontinuerligt förbättra sin miljöprestanda.

När organisationerna beslutar vilka åtgärder som ska vidtas för att förbättra miljöprestandan bör de ta hänsyn till de relevanta delarna i de sektorspecifika referensdokument som avses i artikel 46 i Emas-förordningen, om sådana dokument finns för deras sektor.

De bör särskilt överväga relevant bästa miljöledningspraxis och relevanta riktmärken för resultat i världsklass (som ger en indikation på miljöprestandanivån för de bäst presterande organisationerna) för att identifiera åtgärder och insatser och eventuellt fastställa prioriteringar för att (ytterligare) förbättra sin miljöprestanda.

Det är emellertid inte obligatoriskt att uppfylla bästa miljöledningspraxis eller riktmärkena för resultat i världsklass, eftersom Emas överlåter till organisationerna själva att bedöma om riktmärkena och genomförandet av bästa praxis är rimliga för dem med avseende på kostnader och nytta.

2.2.4    Införande och tillämpning

2.2.4.1   Resurser, roller, ansvar och befogenheter

Om Emas ska fungera måste den högsta ledningen vara beredd att tillhandahålla de resurser och organisationsstrukturer som behövs för att bära upp systemet. Det rör sig bland annat om personalresurser och specialistkunskaper hos personalen, organisatorisk infrastruktur, teknik och finansiella resurser.

Vid miljöutredningen granskar organisationen den befintliga organisatoriska infrastrukturen, ledningspraxis och rutiner. I det här läget är det dags att vid behov anpassa interna strukturer och rutiner.

Organisationens högsta ledning måste utse en representant för ledningen, dvs. en person som är ytterst ansvarig för miljöledningssystemet. Representantens roll är att se till att alla kraven i miljöledningssystemet är uppfyllda, att systemet fungerar och är uppdaterat samt att hålla övriga i ledningsgruppen informerade om hur systemet fungerar. Representanten bör rapportera om för- och nackdelar med systemet och om vilka förbättringar som behövs.

Representanten bör vara kvalificerad och ha erfarenhet av miljöfrågor och kunskap om lagstadgade miljökrav, ledningsaspekter, arbete i arbetsgrupper, ledarskap och samordning. Organisationen måste se till att denna kompetens finns inom organisationen.

Kompetens, utbildning och medvetenhet

Organisationen måste ringa in vilken erfarenhet och kunskap som personalen behöver för att uppvisa god miljöledning.

Den måste upprätta, införa och upprätthålla rutiner för att identifiera utbildningsbehov och göra vad som krävs för att se till att den personal som arbetar med miljöledningssystemet har tillräcklig kunskap om följande:

Organisationens miljöpolicy.

Lagstadgade krav och andra miljökrav som är tillämpliga på organisationen.

De övergripande och detaljerade mål som fastställts för organisationen som helhet och för sitt specifika arbetsområde.

Miljöaspekter och miljöeffekter samt metoder för att övervaka dem.

Sina roller och skyldigheter inom miljöledningssystemet.

Alla som arbetar för eller åt organisationen bör vara medvetna om sina roller inom Emas och systemets fördelar för miljön. De bör få, eller åtminstone ha tillgång till, utbildning i miljömedvetenhet och om organisationens miljöledningssystem.

Figur 5

Flödesschema över utbildning inom miljöledningssystemet

Image

Miljömedvetenhet kan uppnås genom utbildning eller andra åtgärder, till exempel kommunikationskampanjer, undersökningar osv.

Aktivt involverade arbetstagare är en drivkraft för kontinuerliga förbättringar och de bidrar till att förankra Emas i organisationen. De kan bli involverade genom till exempel en miljökommitté, arbetsgrupper, förslagssystem, incitamentprogram eller andra åtgärder.

Arbetstagarna bör ha olika roller på olika nivåer när det gäller utvecklingen och genomförandet av systemet. De skulle till exempel kunna delta i följande delar:

Identifiera miljöaspekter.

Upprätta och omarbeta rutiner och/eller instruktioner.

Komma med förslag till övergripande och detaljerade miljömål.

Delta i ett internt revisionsförfarande.

Upprätta miljöredovisningen enligt Emas.

Ledningen måste ge arbetstagarna löpande återkoppling och be arbetstagarna om detsamma.

2.2.4.2   Kommunikation

Det är viktigt med bra intern och extern tvåvägskommunikation för att genomföra ett Emas-registrerat miljöledningssystem på ett bra sätt. Organisationen måste inse behovet av att kommunicera med berörda parter om miljöfrågor och värdet av att göra detta. Den är skyldig att offentliggöra miljöredovisningen och måste identifiera vad som kommer att kommuniceras och till vem. Den måste övervaka resultatet av kommunikationen och avgöra om den har varit effektiv.

Den interna kommunikationen bör gå i båda riktningarna (uppifrån och ned och nedifrån och upp). Detta kan ske med hjälp av intranät, broschyrer, interna publikationer, nyhetsbrev, förslagslådor, möten, anslagstavlor osv.

Extern kommunikation kan vara miljöredovisningen, internet, aktionsdagar, pressmeddelanden, broschyrer och användningen av Emas-logotypen om detta är möjligt och tillåtet (19).

2.2.4.3   Dokumentation och dokumentstyrning

Det bör finnas dokumentation om miljöledningssystemet som omfattar följande:

Miljöpolicy.

Övergripande och detaljerade miljömål.

Beskrivning av miljöledningssystemets tillämpningsområde.

Beskrivning av miljöledningssystemets huvudsakliga delar.

Roller, skyldigheter och myndigheter.

Rutiner för hantering av verksamhetsstyrningen.

Operativa förfaranden.

Arbetsinstruktioner.

Dokumentationen bör vara tydlig och koncis för att undvika förvirring eller missförstånd.

Emas-dokumenten kan integreras i andra ledningssystem (kvalitets-, energi-, arbetsmiljösystem osv.) eller vice versa för att optimera dem, undvika överlappning och minska byråkratin.

Små och medelstora företag bör sträva efter att förse sin personal med tydlig, enkel och användarvänlig dokumentation.

Miljöledningshandledning

Miljöledningshandledningen omfattar miljöpolicy, miljöprotokoll och verksamheter. Handledningen bör integreras i organisationens årliga förvaltningsplan. Den behöver inte vara lång eller komplex. Den bör hjälpa personalen att förstå hur organisationen har inrättat och strukturerat sina miljöledningssystem, hur miljöledningssystemets olika delar hänger ihop och vilken roll vissa individer har inom ordningen. Handledningen är inte obligatorisk, även om de flesta organisationer väljer att ha en.

Rutiner

I dokumentationen om rutiner beskrivs HUR, NÄR och av VEM specifika åtgärder måste vidtas.

Det kan till exempel vara rutiner för att

identifiera och utvärdera betydande aspekter,

hantera regelefterlevnaden,

hantera identifierade betydande miljöaspekter,

hantera övervakning och mätning,

hantera beredskap för nödsituationer,

hantera avvikelser, korrigerande och förebyggande åtgärder,

identifiera och hantera kompetens, utbildning och medvetenhet,

hantera kommunikation,

hantera dokument,

hantera redovisande dokument,

hantera interna revisioner.

Arbetsinstruktioner

Arbetsinstruktionerna måste vara tydliga och lätta att förstå. De bör förklara en verksamhets relevans, de miljörisker som är förenade med den, specifik utbildning för den personal som ansvarar för att genomföra den och hur den ska övervakas. Det kan vara lämpligt att illustrera instruktionerna med bilder, piktogram eller på andra sätt för att se till att alla arbetstagare lätt kan förstå dem.

Dokumenthantering

Organisationen måste inrätta, genomföra och underhålla rutiner för att hantera de dokument som utarbetats för miljöledningssystemet. Särskild uppmärksamhet bör ägnas åt redovisande dokument (se punkt 2.2.5.4).

Det innebär att det krävs rutiner för följande:

Figur 6

Dokumenthantering inom ett miljöledningssystem

Image

Systemet bör se till att de olika versionerna av dokumenten finns kvar och att de förblir läsbara och lättidentifierbara.

Organisationen kan inkludera dokument från externa källor eftersom de ofta är viktiga för att se till att miljöledningssystemet fungerar som det ska. Sådana dokument kan innehålla information från lokala myndigheter och offentlig förvaltning, användarhandböcker för utrustning, arbetsmiljöinformation osv.

2.2.4.4   Verksamhetsstyrning

Verksamhetsstyrning handlar om att identifiera och planera verksamheter som har betydande miljöaspekter som är förenade med policyn samt övergripande och detaljerade mål (se figur 7). Den kan även omfatta åtgärder som underhåll av utrustning, igångsättning och stängning, hantering av entreprenörer vid anläggningarna och tjänster som tillhandahålls av leverantörer eller försäljare. Det måste finnas rutiner för att hantera konstaterade risker, fastställa detaljerade mål och mäta miljöprestanda (helst med hjälp av tydliga miljöindikatorer). Rutinerna vid normala förhållanden måste definieras. Onormala förhållanden och nödsituationer måste definieras och beskrivas. Rutinerna för verksamhetsstyrningen bör dokumenteras väl och lämnas in för intern revision.

Figur 7

Verksamhetsstyrning

Image

2.2.4.5   Beredskap och agerande vid nödlägen

Organisationen måste upprätta, införa och underhålla rutiner för att identifiera möjliga nödlägen och olyckor för att

undvika risken för olyckor,

beskriva hur organisationen ska agera vid olyckor,

förhindra eller mildra negativ miljöpåverkan.

Beredskapsplanen är viktig i industrin och i organisationer som bedriver potentiellt riskfylld verksamhet.

Organisationen måste regelbundet se över sin beredskap (bland annat lämplig utbildning) och sina beredskapsrutiner. Den bör ändra dem vid behov, särskilt efter nödsituationer eller olyckor. Rutinerna bör även testas med jämna mellanrum.

Figur 8

Beredskapsplaner

Image

2.2.5    Uppföljning

2.2.5.1   Övervakning och mätning

Organisationen måste upprätta, införa och underhålla rutiner för att regelbundet övervaka och mäta betydande faktorer, till exempel utsläpp i luften, avfall, vatten och buller, för att skapa mervärde av resultaten. Organisationen är skyldig att rapportera om kärnindikatorer för prestanda (se punkt 2.3.2).

De lagstadgade övervakningskraven måste beaktas, och övervakningskriterierna, såsom tillsynsfrekvens och metod, måste vara förenliga med dem. Information om dessa kan användas för att garantera följande:

Efterlevnad av lagstadgade krav och förordningar.

Korrekt utvärdering av miljöprestanda.

En fullständig och tydlig miljöredovisning enligt Emas.

Beroende på organisationens behov kan även andra faktorer mätas och övervakas:

Betydande miljöaspekter.

Miljöpolicy och övergripande miljömål.

Personalens medvetenhet m.m.

Mätutrustningen måste kalibreras med jämna mellanrum för att uppfylla lagstiftningen och visa korrekta resultat.

2.2.5.2   Utvärdering av regelefterlevnad

Regelefterlevnaden är ett viktigt krav i Emas-förordningen och en organisation kan inte registrera sig utan att uppfylla kraven i lagstiftningen och den måste därför ha rutiner för att regelbundet se över och utvärdera detta.

Organisationen gör detta bäst genom att upprätta en förteckning över all relevant lagstiftning och alla specifika krav, därefter jämföra detta med organisationens specifika omständigheter (se tabell 6). Större, mer komplexa organisationer kan behöva använda databaser eller anlita extern hjälp.

Om kontrollanten konstaterar avvikelser som inte har åtgärdats får den inte godkänna miljöredovisningen eller underteckna den slutliga deklarationen (bilaga VII).

Tabell 6

Exempel på en enkel utvärdering av regelefterlevnaden

Tillämplig miljölagstiftning

Specifikt krav

Organisationens status

Resultat

Avfallslagstiftning

Tillstånd för avfallsproduktion

Avfallshantering

För gammalt tillstånd

Avfallshantering under kontroll

Skaffa ett uppdaterat tillstånd

Lagstiftning om luftföroreningar

Utsläppsgränser (NOx, SOx, partiklar osv.)

Tillstånd för pannor

Under gränsvärdena

Uppdaterat tillstånd

OK

Bullerlagstiftning

Bullergränser på området

Under tillåten nivå

OK

Avloppsreningslagstiftning

Specifik rening (från P och N)

Gränsvärden för spillvatten

Tillstånd för utsläpp i vattendrag

Inte i drift ännu

Efterlevs inte fullt ut

Tillstånd inte uppdaterat

Åtgärda situationen

Växthusgaslagstiftning

Tilldelning av gränsvärden för växthusgaser

Under gränsvärdena

OK. Kan sälja en del utsläppsrätter

2.2.5.3   Avvikelser, korrigerande och förebyggande åtgärder

Organisationen måste upprätta, införa och underhålla rutiner för att hantera inträffade eller tänkbara avvikelser från kraven i Emas-förordningen.

Det måste bland annat finnas rutiner för hur man ska

identifiera och korrigera avvikelser,

utreda avvikelsernas orsak och verkan,

utvärdera behovet av åtgärder för att förhindra att avvikelserna upprepas,

dokumentera resultaten av korrigerande åtgärder,

utvärdera behovet av åtgärder för att förhindra avvikelser,

genomföra lämpliga förebyggande åtgärder för att förhindra sådana avvikelser, och

granska de korrigerande och förebyggande åtgärdernas ändamålsenlighet.

Med avvikelse avses all typ av underlåtenhet att uppfylla de grundläggande krav som anges i rutiner och tekniska anvisningar.

Avvikelser kan bero på den mänskliga faktorn eller felaktigt genomförande. Ändringar för att korrigera avvikelserna och förhindra att de upprepas måste göras så snart som möjligt.

Avvikelser kan upptäckas genom

verksamhetsstyrning,

intern/extern revision,

ledningens genomgång, eller

den dagliga verksamheten.

Korrigerande och förebyggande åtgärder

Emas representant för ledningen måste informeras om avvikelser för att i tillämpliga fall kunna fatta beslut om att vidta korrigerande åtgärder.

Om tänkbara avvikelser har identifierats måste Emas representant för ledningen informeras för att i tillämpliga fall kunna fatta beslut om att vidta förebyggande åtgärder.

Både korrigerande och förebyggande åtgärder bör dokumenteras. Det kan därför vara nödvändigt att ändra miljöledningssystemets dokumentation.

2.2.5.4   Kontroll av redovisande dokument

Organisationen måste inrätta ett dokumentationssystem för att visa att den uppfyller kraven på miljöledningssystemet.

Organisationen måste upprätta, införa och underhålla rutiner för sin dokumenthantering. Dessa bör omfatta frågor som identifiering, lagring, skydd, hämtning, arkivering och gallring av redovisande dokument.

De redovisande dokumenten ska vara och förbli identifierbara, tydliga, uppdaterade och spårbara.

Exempel på redovisande dokument:

El-, vatten- och råvaruförbrukning.

Avfallsproduktion (farligt och ofarligt avfall).

Utsläpp av växthusgaser.

Incidenter, olyckor och klagomål.

Lagstadgade krav.

Revisionsrapporter och ledningens genomgångar.

Tillsynsrapporter.

Betydande miljöaspekter.

Avvikelser, korrigerande och förebyggande åtgärder.

Kommunikation och utbildning.

Förslag från personalen.

Utbildning och seminarier.

2.2.6    Intern revision

Emas ägnar särskild uppmärksamhet åt den interna revisionen i bilaga III.

Intern miljörevision: en systematisk, dokumenterad, regelbunden och objektiv utvärdering av en organisations miljöprestanda och de ledningssystem och processer som upprättats för att skydda miljön.

Organisationen måste upprätta ett internt revisionsförfarande som en del av ledningssystemet. Detta måste omfatta skyldigheter och krav för planering och genomförande av revisioner, rapportering av resultat och bevarande av redovisande dokument, fastställande av revisionskriterier, omfattning, frekvens och metoder.

Målet med den interna revisionen är att

avgöra om miljöledningssystemet uppfyller kraven i Emas-förordningen,

avgöra om det har genomförts och underhållits ordentligt,

garantera att organisationens ledning får den information som den behöver för att granska organisationens miljöprestanda,

avgöra om miljöledningssystemet är ändamålsenligt.

Revisionen måste genomföras objektivt av oberoende personal. Den interna revisorn kan vara en utbildad medarbetare eller en extern person eller grupp.

Allmänna regler

Upprätta ett revisionsprogram.

Fastställ revisionens omfattning. Detta beror på organisationens storlek och typ. Vid angivelse av revisionens omfattning måste organisationen ange vilka ämnesområden som omfattas, vilka verksamheter som ska granskas, vilka miljökriterier som ska beaktas och vilken period som revisionen ska omfatta.

Ange vilka resurser som behövs för att genomföra revisionen, till exempel välutbildad personal med god kunskap om verksamheten, tekniska aspekter, miljöaspekter och lagstadgade krav.

Se till att alla åtgärder i organisationen genomförs i enlighet med tidigare definierade rutiner.

Identifiera potentiella nya problem och inrätta åtgärder för att förhindra att de inträffar.

Den interna revisionens olika steg

Figur 9

Den interna revisionens olika steg

Image

2.2.6.1   Revisionsprogram och revisionsfrekvens

Revisionsprogrammet måste omfatta följande:

Specifika mål för den interna revisionen.

Information om hur det kan kontrolleras om miljöledningssystemet är enhetligt och förenligt med organisationens policy och program samt uppfyller kraven i Emas-förordningen.

Efterlevnad av tillämplig miljölagstiftning.

Organisationen måste varje år göra interna revisioner för att få en ordentlig överblick över betydande miljöaspekter. Revisionscykeln, som omfattar hela organisationens verksamhet, måste fullbordas inom tre år. Små organisationer får förlänga denna period till fyra år.

Hur ofta en viss verksamhet granskas varierar beroende på följande:

Verksamhetens art, omfattning och komplexitet.

Betydelsen av den miljöpåverkan som är förenad med verksamheten.

Hur viktiga och brådskande de problem är som upptäckts vid tidigare revisioner.

Tidigare miljöproblem.

I regel måste komplexa verksamheter med en mer betydande miljöpåverkan granskas oftare.

För att få ett tillfredsställande resultat måste all personal som deltar i en intern revision ha en tydlig uppfattning om de övergripande miljömålen och alla deltagares specifika roller (styrelseledamöter, ledningspersoner, anställda, revisorer osv.).

2.2.6.2   Internrevisionsåtgärder

Det är viktigt att på förhand förbereda den interna revisionen. Det första steget är att identifiera revisorn/revisionsgruppen. Organisationen kan använda sin egen personal som revisorer eller anlita externa revisorer. De måste vara objektiva och opartiska och ha erforderlig kompetens och utbildning. Revisorn/revisionsgruppen bör göra följande:

Utarbeta en bra revisionsplan, genom att samla in information om övergripande mål, omfattning, plats och datum efter överenskommelse med organisationen.

Överlämna revisionsplanen till organisationen i god tid.

Upprätta checklistor.

Fördela arbetsuppgifterna inom revisionsgruppen.

För att revisionen ska vara meningsfull måste revisionsgruppen kontrollera efterlevnaden med miljölagstiftningen, om de övergripande och detaljerade målen har uppfyllts, och om ledningssystemet är ändamålsenligt och tillräckligt.

Revisionsförfarandet måste innehålla följande steg:

Ta reda på hur ledningssystemet fungerar.

Utvärdera systemets styrkor och svagheter.

Samla in relevant faktaunderlag (t.ex. uppgifter, redovisande dokument och andra handlingar).

Utvärdera revisionsresultaten.

Utarbeta slutsatser av revisionen.

Rapportera resultat och slutsatser av revisionen.

2.2.6.3   Rapportering av resultat och slutsatser av revisionen

Syftet med revisionsrapporten är att förse ledningen med

skriftligt underlag om revisionens omfattning,

information om i vilken utsträckning de övergripande målen har uppfyllts,

information om huruvida de övergripande målen är förenliga med organisationens miljöpolicy,

information om övervakningssystemets tillförlitlighet och ändamålsenlighet,

förslag till korrigerande åtgärder vid behov.

Rapporten måste överlämnas till Emas representant för ledningen som, om avvikelser (inklusive bristande regelefterlevnad) har konstaterats, slutför de korrigerande åtgärderna.

2.2.7    Ledningens genomgång

Den högsta ledningen måste regelbundet (minst en gång per år) gå igenom ledningssystemet för att se till att det är ändamålsenligt och effektivt. Ledningens genomgång måste dokumenteras, och dokumentationen bevaras.

Innehållet i ledningens genomgång

Insatsfaktorer:

Resultatet av den interna revisionen, bland annat en utvärdering av regelefterlevnad.

Extern kommunikation.

Klagomål.

I vilken utsträckning de övergripande och detaljerade målen har uppfyllts.

Status för korrigerande och förebyggande åtgärder.

Uppföljning av ledningens tidigare genomgångar.

Ändrade omständigheter, t.ex. ändrad lagstiftning, miljöförändringar.

Rekommendationer om förbättringar.

Resultatfaktorer omfattar alla beslut och verksamheter, ändringar av miljöpolicyn, övergripande och detaljerade miljömål och andra aspekter av miljöledningssystemet.

2.3   EMAS-MILJÖREDOVISNING

Miljöredovisning: utförlig information till allmänheten och andra intressenter om en organisations struktur och verksamhet, miljöpolicy och miljöledningssystem, miljöaspekter och miljöpåverkan, miljöprogram samt övergripande och detaljerade miljömål, miljöprestanda och efterlevnad av tillämpliga lagstadgade miljökrav.

Miljöredovisningen är en av de saker som gör Emas unikt jämfört med andra miljöledningssystem.

För allmänheten bekräftar den organisationens åtagande om att vidta åtgärder för miljön.

För organisationen är miljöredovisningen ett bra tillfälle att förklara vad den gör för att förbättra miljön.

I Emas-förordningen anges vissa minimikrav för vad miljöredovisningen ska innehålla men organisationen kan själv bestämma hur detaljerad den vill vara samt välja struktur och layout, så länge innehållet är tydligt, tillförlitligt, trovärdigt och korrekt. Det är upp till organisationen att besluta om den vill inkludera sin miljöredovisning i årsredovisningen eller i andra rapporter, t.ex. om företagets sociala ansvar.

2.3.1    Minimikrav på innehållet i miljöredovisningen enligt Emas

1.   En klar och entydig beskrivning av den organisation som ska registreras enligt Emas och en sammanfattning av dess verksamhet, produkter och tjänster samt, i förekommande fall, dess relation till eventuella moderorganisationer

Inkludera diagram, kartor, flödesscheman, flygfotografier osv. för att illustrera innehållet. Nace-koder bör också anges för att beskriva verksamheten.

2.   Organisationens miljöpolicy och en kort beskrivning av organisationens miljöledningssystem

Det är viktigt med en korrekt beskrivning av systemet för att ge tydlig information om arbetsstrukturen. Miljöpolicyn måste inkluderas.

3.   En beskrivning av alla betydande direkta och indirekta miljöaspekter som resulterar i betydande miljöpåverkan från organisationens sida och en förklaring av arten av påverkan i relation till dessa aspekter (bilaga I.2 till Emas-förordningen)

Direkta och indirekta miljöaspekter bör anges separat. Både de direkta och de indirekta miljöaspekternas miljöpåverkan bör anges med hjälp av tabeller eller flödesscheman.

4.   En beskrivning av de övergripande och detaljerade miljömålen satta i relation till de betydande miljöaspekterna och den betydande miljöpåverkan

Använd förteckningar över övergripande och detaljerade mål samt indikatorer för att bedöma de framsteg som görs för att förbättra prestandan. Inkludera miljöprogrammet och hänvisa till specifika vidtagna eller planerade åtgärder för att förbättra prestandan.

5.   En sammanfattning av tillgängliga uppgifter om organisationens miljöprestanda i relation till dess övergripande och detaljerade miljömål med avseende på dess betydande miljöpåverkan. Rapporteringen ska avse kärnindikatorer och andra befintliga indikatorer för miljöprestanda som kan vara av relevans, i enlighet med avsnitt C i bilaga IV till Emas-förordningen

Kärnindikatorerna är inriktade på sex huvudområden: energi, material, vatten, avfall, biologisk mångfald (genom markanvändning) och utsläpp (se punkt 2.3.2.2).

Organisationen ska även rapportera sin prestanda enligt övriga, mer specifika indikatorer för betydande miljöaspekter som nämns i miljöutredningen (se punkt 2.3.2.3). Om inga kvantitativa uppgifter finns tillgängliga för att rapportera betydande direkta eller indirekta miljöaspekter ska organisationerna rapportera sina prestanda på grundval av kvalitativa indikatorer.

Om de sektorspecifika referensdokument som avses i artikel 46 i Emas-förordningen finns för den specifika sektorn bör organisationerna ta hänsyn till de relevanta sektorspecifika miljöprestandaindikatorerna i det sektorspecifika referensdokumentet när de väljer vilka indikatorer (20) de ska använda i miljöprestandarapporteringen.

6.   Övriga faktorer med avseende på miljöprestanda, bl.a. miljöprestanda i relation till lagstadgade krav och deras betydande miljöpåverkan

Använd tabeller och/eller diagram för att jämföra lagstadgade referensgränsvärden med gränsvärden som uppmätts och/eller beräknats av organisationen.

Det är inte alltid möjligt att mäta miljöprestanda med hjälp av data. Mjuka faktorer är också relevanta och kan omfatta beteendeförändringar, förbättrade rutiner och andra åtgärder för att förbättra miljöprestanda.

Vid rapporteringen om dessa andra faktorer bör organisationerna ta hänsyn till de relevanta sektorspecifika referensdokument som avses i artikel 46 i Emas-förordningen. De bör därför ange i sin miljöredovisning hur de har använt relevant bästa miljöledningspraxis och i förekommande fall riktmärken för resultat i världsklass för att identifiera åtgärder och insatser och eventuellt fastställa prioriteringar för att (ytterligare) förbättra sin miljöprestanda.

Organisationen bör bedöma relevansen och tillämpligheten för bästa miljöledningspraxis och riktmärkena för resultat i världsklass med beaktande av de betydande miljöaspekter som organisationen själv har identifierat i sin miljöutredning samt tekniska och ekonomiska aspekter.

De delar av det sektorspecifika referensdokumentet (indikatorer, bästa miljöledningspraxis eller riktmärken för resultat i världsklass) som inte anses vara relevanta för de betydande miljöaspekter som organisationen har identifierat i miljöutredningen bör inte rapporteras eller beskrivas i miljöredovisningen.

7.   En hänvisning till de tillämpliga lagstadgade miljökraven

Emas kräver regelefterlevnad. Miljöredovisningen utgör en möjlighet att ange hur organisationen uppfyller detta.

Även om Emas-registrerade organisationer bör ha en intern förteckning över alla relevanta lagstadgade krav är det inte nödvändigt att inkludera dem i miljöredovisningen. Här räcker det med en beskrivning.

8.   Miljökontrollantens namn och ackrediterings- eller licensnummer samt datum för godkännandet

Om organisationen offentliggör sin miljöredovisning som en del av en annan rapport bör den ange att det rör sig om en miljöredovisning och att den har godkänts av miljökontrollanten. Även om det inte är obligatoriskt att bifoga den deklaration som avses i artikel 25.9 till miljöredovisningen anses det vara bästa praxis att göra det.

2.3.2    Kärnindikatorer och andra relevanta indikatorer för miljöprestanda

2.3.2.1   Kärnindikatorer

Organisationerna måste informera om de kärnindikatorer för miljöprestanda som berör organisationens direkta miljöaspekter. De bör även rapportera om andra resultatindikatorer som berör mer specifika miljöaspekter. De bör ta hänsyn till sektorspecifika referensdokument om sådana finns.

Kärnindikatorer avser alla typer av organisationer. De används för att mäta prestandan inom följande viktiga områden:

Energi.

Material.

Vatten.

Avfall.

Markanvändning med avseende på biologisk mångfald.

Utsläpp.

Varje kärnindikator består av en siffra A (tillförsel), en siffra B (produktion) och en siffra R för förhållandet A/B.

i)   Siffra A (tillförsel)

Tillförseln (siffra A) rapporteras enligt följande:

Energi:

a)

Total årlig energianvändning, uttryckt i MWh eller GJ.

b)

Den procentuella andelen av (a) som kommer från förnybara energikällor som produceras av organisationen.

Indikatorn (b) anger den procentuella andelen av den årliga energianvändningen som kommer från förnybara energikällor som faktiskt produceras av organisationen. Energi som köps av en energileverantör ingår inte i den här indikatorn och kan anses utgöra en del av åtgärderna inom miljöanpassad offentlig upphandling.

Material:

Årligt massflöde för olika material som används, uttryckt i ton, utom energibärare och vatten.

Det årliga massflödet för olika material kan delas in efter användningsområde. De kan till exempel inkludera råvaror som metall, trä eller kemikalier, eller halvfabrikat, beroende på organisationens verksamhet.

Vatten:

Sammanlagd årlig vattenförbrukning, uttryckt i m3.

För denna indikator måste organisationen rapportera den sammanlagda mängd vatten som organisationen förbrukar.

Det är lämpligt att förtydliga de olika typerna av vattenförbrukning och att rapportera förbrukningen efter vattenkälla, t.ex. ytvatten eller grundvatten.

Annan användbar information kan vara mängden avloppsvatten, renat och återanvänt avloppsvatten, regnvatten och återvinning av gråvatten.

Avfall:

Detta omfattar den sammanlagda årliga produktionen av

avfall (fördelat på avfallstyp), uttryckt i ton,

farligt avfall, uttryckt i ton eller kilo.

Rapporteringen av avfall och farligt avfall är obligatorisk enligt Emas-förordningen. Det är god praxis att dela in avfallet efter typ för båda avfallsströmmarna. Organisationen bör utgå från resultatet av ledningens genomgång, inklusive lagstadgade krav om rapportering av avfall. En mer detaljerad rapportering kan göras enligt det nationella avfallsklassificeringssystemet för genomförande av den europeiska avfallsförteckningen.

Det kan vara kontraproduktivt och förvirrande ur kommunikationssynpunkt att redogöra för långa förteckningar över avfallstyper och därför kan ett alternativ vara att gruppera informationen enligt den europeiska förteckningen. De olika typerna av avfall, t.ex. metaller, plast, papper, slam och aska, kan därefter dokumenteras efter vikt eller volym. Det kan även vara lämpligt att lägga till information om mängden avfall som återanvänds, återvinns, används vid energiproduktion eller deponeras.

Markanvändning med avseende på biologisk mångfald:

Markanvändning, uttryckt i m2 bebyggt område.

Biologisk mångfald är en komplex och relativt ny kärnindikator. Vissa av de faktorer som leder till förlust av biologisk mångfald (klimatförändringen, utsläpp/föroreningar) ingår redan i miljöaspekter och relaterade indikatorer i Emas-förordningen, som omfattar energi- och vattenförbrukning, utsläpp, avfall osv.

Alla indikatorer för biologisk mångfald är inte relevanta för alla sektorer/organisationer och alla kan inte genomföras direkt när dessa aspekter börjar hanteras. Miljöutredningen bör ge en bra indikation om vilka faktorer som är relevanta. Organisationen bör inte bara ta hänsyn till lokal påverkan utan även direkt och indirekt påverkan på den biologiska mångfalden i stort, t.ex. utvinning av råvaror, upphandlingar/distributionskedjan, produktion och produkter, transport och logistik, marknadsföring och kommunikation. Det finns ingen indikator som berör alla organisationer.

Den biologiska mångfaldsindikatorn för markanvändning i bilaga IV till Emas-förordningen kan ses som en gemensam nämnare. Den omfattar endast organisationens anläggningar i bebyggda områden. Organisationerna rekommenderas dock att även inkludera hårdgjorda områden i indikatorn för markanvändning.

Utsläpp:

a)

Sammanlagda årliga utsläpp av växthusgaser (CO2, CH4, N2O, hydrofluorkarboner, perfluorkarboner och SF6), uttryckt i ton koldioxidekvivalenter.

b)

Sammanlagda årliga utsläpp i luften (vilket minst ska omfatta utsläpp av SO2, NOx och PM), uttryckt i kilogram eller ton.

Anm.: Eftersom dessa ämnen har olika påverkan bör de inte sammanräknas.

Organisationen måste förtydliga vilken metod den har använt för att kvantifiera utsläppen, särskilt växthusgaser och luftföroreningar (21). Till att börja med måste organisationen ta hänsyn till gällande lagstadgade krav. Detta gäller uppenbarligen för organisationer vars anläggningar omfattas av EU:s system för handel med utsläppsrätter eller förordningen om ett europeiskt register över utsläpp och överföringar av föroreningar. I andra fall får eventuella europeiska, globalt erkända eller nationella/regionala gemensamma metoder tillämpas.

Även om rapporteringen av kärnindikatorer endast är obligatorisk för direkta aspekter måste organisationen ta hänsyn till alla betydande miljöaspekter, direkta och indirekta. Det är därför bäst att rapportera betydande indirekta växthusgasutsläpp, helst separat från direkta utsläpp.

ii)   Siffra B (produktion)

Den sammanlagda årliga produktionen (siffra B) är densamma för alla områden, men anpassas till olika typer av organisationer:

a)

Produktionssektorn (industrin): Ange det sammanlagda bruttoförädlingsvärdet, uttryckt i miljoner euro eller den sammanlagda årliga fysiska produktionen, uttryckt i ton. Små organisationer får ange den sammanlagda årliga omsättningen eller antalet anställda.

b)

Icke-produktionssektorerna (tjänster, förvaltning): Ange antalet anställda.

2.3.2.2   Kärnindikatorer och viss flexibilitet i samband med dessa – syfte

Det är viktigt att förstå syftet med indikatorerna och flexibiliteten i samband med dessa i Emas-förordningen (bilaga IV till Emas-förordningen).

I bilaga IV C.1 anges att indikatorerna måste

a)

ge en korrekt värdering av organisationens miljöprestanda,

b)

vara förståeliga och entydiga,

c)

tillåta årliga jämförelser för bedömningar av organisationens miljöprestanda,

d)

i förekommande fall möjliggöra jämförelse med referenstal inom den aktuella sektorn, det aktuella landet eller den aktuella regionen,

e)

möjliggöra en jämförelse med tillämpliga lagstadgade krav.

Detta är kärnindikatorernas huvudfunktioner.

Det finns dock viss flexibilitet kring hur indikatorerna används om detta gör det lättare för indikatorerna att fylla sin funktion.

Flexibiliteten gäller följande:

Villkor för användningen av den konfidentialitetsklausul som avses i bilaga IV C.1 – ”Om tillkännagivandet negativt skulle påverka konfidentialiteten när det gäller organisationens affärs- eller industriinformation […] får organisationen indexera denna information i sin rapportering, t.ex. genom att fastställa ett basår (med index 100) som utvecklingen av den faktiska förbrukningen/påverkan hänför sig till.” Denna klausul kan åberopas om användningen av en indikator skulle kunna röja känslig information som skulle kunna göra det möjligt för en konkurrent att beräkna genomsnittspriset för produktionen.

Villkor för att INTE rapportera om en viss kärnindikator i bilaga IV – I bilaga IV C.2 a och b om kärnindikatorer anges följande: ”Om en organisation kommer fram till att en eller flera kärnindikatorer inte är relevanta för deras betydande direkta miljöaspekter, får denna organisation välja att inte rapportera om dessa kärnindikatorer. Organisationen ska kunna motivera detta med hänvisning till sin miljöutredning.” För öppenhetens skull bör denna motivering även nämnas i miljöredovisningen. Eftersom varje kärnindikator består av en siffra A för tillförsel, B för produktion och R för förhållandet A/B gäller denna flexibilitet hela kärnindikatorn som sådan, inklusive det specifika förhållandet A/B.

Villkor för rapportering av en annan indikator (A/B) I STÄLLET FÖR en specifik kärnindikator som i bilaga IV – Om en organisation väljer att inte rapportera en eller flera specifika indikatorer enligt bilaga IV, utan väljer en annan i stället, måste denna indikator också ha en tillförselsiffra A och en produktionssiffra B. Om organisationen använder sig av denna flexibilitet bör den alltid motivera detta med hänvisning till miljöutredningen, där man visar hur det valda alternativet ger en bättre bild av den aktuella prestandan. För denna specifika bestämmelse bör organisationen ta hänsyn till Emas sektorspecifika referensdokument, om sådant finns för den aktuella sektorn. Exempel: i stället för ”antal anställda” kan ett företag som erbjuder boende för turister välja ”antal gästnätter”, en skola kan välja ”antal elever”, ett avfallshanteringsföretag kan välja ”mängd hanterat avfall i ton” och ett sjukhus kan välja ”antal övernattande patienter” osv.

Villkor för att använda andra sätt för att uttrycka tillförsel (A) och produktion (B), UTÖVER de specifika kärnindikatorer som anges i bilaga IV – En organisation kan även använda andra sätt för att uttrycka sammanlagd årlig tillförsel/påverkan inom ett visst område och den sammanlagda årliga produktionen. Exempel: en tjänsteorganisation kan i sin rapportering använda ”antal anställda” som ett mått på produktionen (B) för sin administrativa del och ett annat mått på produktionen för den specifika tillhandahållna tjänsten.

Måttenheter – Om de som anges i bilaga IV till Emas-förordningen inte tydligt återspeglar organisationens miljöprestanda och inte ger en tydlig bild ur kommunikationssynpunkt får organisationen använda sig av alternativa måttenheter, så länge den motiverar detta. Enheterna måste kunna omvandlas till dem som anges i förordningen. Helst bör en fotnot med en förklaring av omvandlingen infogas.

Användning av andra valutor än euro för bruttoförädlingsvärde eller årsomsättning – Även om det i Emas-förordningen står ”miljoner euro” som ett produktionsmått för bruttoförädlingsvärde får organisationer i länder som inte tillhör euroområdet använda sin nationella valuta.

2.3.2.3   Övriga relevanta indikatorer för miljöprestanda

Organisationen måste även rapportera sin prestanda enligt övriga relevanta indikatorer för betydande miljöaspekter som nämns i miljöutredningen.

Om sådana referensdokument som avses i artikel 46 i Emas-förordningen finns för den specifika sektorn, ska bedömningen av organisationens miljöprestanda göras mot bakgrund av dokumentet i fråga.

Organisationerna bör därför ta hänsyn till de relevanta sektorspecifika miljöprestandaindikatorerna i det sektorspecifika referensdokumentet när de väljer vilka indikatorer (22) de ska använda i miljöprestandarapporteringen. De bör ta hänsyn till de indikatorer som föreslås i motsvarande sektorspecifika referensdokument samt indikatorernas relevans för de betydande miljöaspekter som organisationen identifierat i miljöutredningen. Indikatorerna bör endast beaktas om de är relevanta för de miljöaspekter som anses vara de mest betydande i miljöutredningen.

2.3.2.4   Lokal redovisningsskyldighet

Den lokala redovisningsskyldigheten är en viktig del av Emas-förordningen. Därför bör alla Emas-registrerade organisationer rapportera om varje anläggnings betydande miljöpåverkan på det sätt som beskrivs i bilaga IV till förordningen.

I vilket fall som helst bör information om trender när det gäller utsläpp till luft och vatten, vattenförbrukning, energianvändning och avfallsmängd anges på anläggningsnivå. När det kontrollförfarande för organisationer med flera anläggningar som beskrivs i punkt 2.4.3 i denna användarhandledning tillämpas, kan sådan information lämnas för grupper av anläggningar under förutsättning att siffrorna korrekt avspeglar utvecklingen på anläggningsnivå.

Organisationen får endast indexera informationen av konfidentialitetsskäl (se punkt 2.3.2.2).

Dessutom måste organisationen beakta att det är möjligt att göra fortlöpande förbättringar på permanenta anläggningar men inte på tillfälliga anläggningar. Om detta är en relevant aspekt bör det anges i miljöutredningen. Hänsyn bör även tas till möjligheten att tillämpa alternativa åtgärder, till exempel andra ”mjuka” (kvalitativa) indikatorer. I vilket fall som helst kan hänsyn tas till information om tillfälliga anläggningar när det gäller sektorer som omfattas av Emas sektorspecifika dokument.

Tabell 7

Exempel på användningen av kärnindikatorer för prestanda i offentlig förvaltning

Kärnindikator

Årlig tillförsel/påverkan (A)

Organisationens sammanlagda årliga produktion (B)

Förhållandet A/B

Energi

Årlig förbrukning i MWh, GJ

Antal anställda (icke-producerande sektorer)

MWh/person och/eller KWh/person

Material

Årlig förbrukning av papper i ton

Antal anställda (icke-producerande sektorer)

Ton/person och/eller antalet pappersark/person/dag

Vatten

Årlig förbrukning m3

Antal anställda (icke-producerande sektorer)

m3/person och/eller l/person

Avfall

Årlig avfallsproduktion i ton

Antal anställda (icke-producerande sektorer)

Ton avfall/person och/eller kg/person

Årlig produktion av farligt avfall i kilo

kg farligt avfall/person

Markanvändning med avseende på biologisk mångfald

Markanvändning, m2 bebyggt område (inklusive hårdgjort område)

Antal anställda (icke-producerande sektorer)

m2 bebyggt område/person och/eller m2 hårdgjort område/person

Utsläpp av växthusgaser

Årliga utsläpp av växthusgaser i ton koldioxidekvivalenter

Antal anställda (icke-producerande sektorer)

ton koldioxidekvivalenter/person och/eller

kg koldioxidekvivalenter/person


Tabell 8

Exempel på användningen av kärnindikatorer för prestanda i produktionssektorn

Kärnindikator

Årlig tillförsel/påverkan (A)

Organisationens sammanlagda årliga produktion (B)

Förhållandet A/B

Energi

Årlig förbrukning i MWh, GJ

Sammanlagt årligt bruttoförädlingsvärde (miljoner euro) (*1)

eller

sammanlagd årlig fysisk produktion (ton)

MWh/miljoner euro

eller

MWh/ton av produkten

Material

Årligt massflöde för olika material som används, i ton

Sammanlagt årligt bruttoförädlingsvärde (miljoner euro) (*1)

eller

sammanlagd årlig fysisk produktion (ton)

För vart och ett av de olika material som används:

Material i ton/miljoner euro

eller

material i ton av produkten

Vatten

Årlig förbrukning m3

Sammanlagt årligt bruttoförädlingsvärde (miljoner euro) (*1)

eller

sammanlagd årlig fysisk produktion (ton)

m3/miljoner euro

eller

m3/ton av produkten

Avfall

Årlig avfallsproduktion i ton

Sammanlagt årligt bruttoförädlingsvärde (miljoner euro) (*1)

eller

sammanlagd årlig fysisk produktion (ton)

Ton avfall/miljoner euro

eller

ton avfall/ton av produkten

Årlig produktion av farligt avfall i ton

Ton farligt avfall/miljoner euro

eller

ton farligt avfall/ton av produkten

Markanvändning med avseende på biologisk mångfald

Markanvändning, m2 bebyggt område (inklusive hårdgjort område)

Sammanlagt årligt bruttoförädlingsvärde (miljoner euro) (*1)

eller

sammanlagd årlig fysisk produktion (ton)

m2 bebyggt område och/eller

m2 hårdgjort område/miljoner euro

eller

m2 bebyggt område och/eller

m2 hårdgjort område/ton av produkten

Utsläpp av växthusgaser

Årliga utsläpp av växthusgaser i ton koldioxidekvivalenter

Sammanlagt årligt bruttoförädlingsvärde (miljoner euro) (*1)

eller

sammanlagd årlig fysisk produktion (ton)

Ton koldioxidekvivalenter/miljoner euro

eller

ton koldioxidekvivalenter/ton av produkten

2.4   KONTROLL OCH GODKÄNNANDE

Kontroll: den bedömning av överensstämmelse som genomförs av en miljökontrollant för att visa om en organisations miljöutredning, miljöpolicy, miljöledningssystem och interna miljörevision samt dess genomförande uppfyller kraven i denna förordning.

Godkännande: bekräftelse av den miljökontrollant som har utfört kontrollen att informationen och uppgifterna i en organisations miljöredovisning och uppdaterade miljöredovisning är tillförlitliga, trovärdiga och korrekta och uppfyller kraven i denna förordning.

2.4.1    Vem får kontrollera och godkänna Emas?

Endast ackrediterade eller licensierade miljökontrollanter får utföra dessa uppgifter.

Miljökontrollant: ett organ för bedömning av överensstämmelse enligt definitionen i [Europaparlamentets och rådet] förordning (EG) nr 765/2008 (23) eller en förening eller grupp av sådana organ som har fått ackreditering i enlighet med den här förordningen, eller en fysisk eller juridisk person eller en förening eller grupp av sådana personer som har fått licens att bedriva kontroll- och godkännandeverksamhet i enlighet med den här förordningen (24).

Organisationen kan kontakta det behöriga organet för Emas i sin medlemsstat eller det ackrediterings- eller licensieringsorgan som ansvarar för ackrediteringen av Emas-kontrollanter för att få information om ackrediterade miljökontrollanter. Om en organisation vill ha information om kontrollanter som är verksamma inom organisationens sektor från andra medlemsstater än den egna är denna information tillgänglig via EU:s Emas-register (25).

En ackrediterad eller licensierad miljökontrollants behörighetsområde bestäms utifrån de Nace-koder och den näringsgrensindelning som anges i Europaparlamentets och rådets förordning (EG) nr 1893/2006 (26). När en organisation anlitar en miljökontrollant måste den försäkra sig om att kontrollanten är ackrediterad eller licensierad för den specifika Nace-kod som gäller för organisationens verksamhet.

En kontrollant som har ackrediterats eller licensierats i en medlemsstat får verka i alla EU-länder (27).

Information om ackrediterade eller licensierade kontrollanter finns tillgänglig på kommissionens Emas-webbplats eller kan erhållas via behöriga organ i medlemsstaterna.

Anm.: Organisationen bör kontrollera om kontrollanten minst fyra veckor före kontrollen har lämnat den information som anges i artikel 24 i Emas-förordningen till det ansvariga ackrediterings- eller licensieringsorganet för att möjliggöra tillsyn från ackrediterings- eller licensieringsorganet i den medlemsstat där kontrollanten vill verka. I avsaknad av tillsyn får det behöriga organet neka organisationen registrering.

2.4.2    Miljökontrollanternas uppgifter

1.

Kontrollera om organisationen uppfyller alla krav i Emas-förordningen när det gäller den inledande miljöutredningen, miljöledningssystemet, miljörevisionen och dess resultat samt miljöredovisningen.

2.

Kontrollera om organisationen uppfyller tillämpliga europeiska, nationella, regionala och lokala lagstadgade miljökrav.

Anm. 1: Kontrollanten måste kontrollera om organisationen har upprättat, infört och underhållit rutiner för att regelbundet utvärdera att tillämpliga lagstadgade krav är uppfyllda (28). Kontrollanten gör en noggrann kontroll av företagets regelefterlevnad. En del av denna uppgift är att på grundval av inkommet faktaunderlag kontrollera att det inte finns några belägg för överträdelse av miljölagstiftningen (29). Kontrollanten får använda tillsynsmyndigheternas iakttagelser. Om den inte hittar några belägg för avvikelser anges detta i miljödeklarationen som undertecknas av kontrollanten. Kontrollantens uppgift är dock att med hjälp av sedvanliga revisionsmetoder kontrollera att kraven i förordningen är uppfyllda. Detta innebär att kontrollanten inte kommer att kunna kontrollera regelefterlevnaden på samma sätt som tillsynsmyndigheterna gör.

Anm. 2: Om en kontrollant upptäcker en avvikelse eller bristande regelefterlevnad under perioden mellan två registreringar har den följande alternativ. Kontrollanten kan rapportera till det behöriga organet att organisationen i fråga måste avregistreras ur Emas-registret. Alternativt kan kontrollanten, om organisationen har visat att den i god tid har vidtagit åtgärder i samarbete med tillsynsmyndigheterna för att uppfylla de lagstadgade kraven, fortfarande underteckna deklarationen om kontroll och godkännande i bilaga VII till förordningen.

3.

Kontrollera organisationens kontinuerliga förbättringar av miljöprestandan.

4.

Kontrollera att den information som anges och används i miljöredovisningen samt eventuell annan miljöinformation som ska godkännas är tillförlitlig, trovärdig och korrekt.

5.

Besöka organisationen eller anläggningen. Rutinerna ser olika ut beroende på om organisationen har en eller flera anläggningar och det är viktigt att betona skillnaderna i respektive fall. Enligt Emas-förordningen (artikel 25.4) ska kontrollanten besöka organisationen vid varje kontroll/godkännande.

a)

Om organisationen bara har en anläggning så betyder det att kontrollanten måste besöka anläggningen varje år.

b)

Om det rör sig om en liten organisation som bara har en anläggning och om undantaget för små organisationer är tillämpligt (artikel 7) måste kontrollen/godkännandet göras efter två och fyra år vilket innebär att kontrollanten är skyldig att besöka anläggningen efter två och fyra år.

c)

Om det däremot rör sig om en registrerad organisation med flera anläggningar måste kontrollanten enligt artikel 25.4 fortfarande besöka organisationen vid varje kontroll/godkännande. Ur juridisk synvinkel kan denna skyldighet anses vara uppfylld om kontrollanten besöker organisationen (kanske en anläggning, kanske olika anläggningar) varje år.

Med hänsyn till kontrollantens arbetsuppgifter och kontrollantens slutsats om regelefterlevnad, måste besöksprogrammet dock vara utformat på ett sådant sätt att varje anläggning som ingår i registreringsnumret för en organisation med flera anläggningar besöks (och genomgår en fullständig kontroll) åtminstone en gång på 36 månader. Om kontrollanten inte gör en fullständig kontroll av samtliga ingående anläggningar åtminstone en gång på 36 månader anses kontrollanten inte fullgöra sina skyldigheter enligt Emas III-förordningen. Detta innebär också att miljökontrollanten före den första registreringen av en organisation med flera anläggningar måste besöka samtliga dessa anläggningar.

Som ett undantag från denna allmänna regel kan en urvalsmetod användas för kontroll av organisationer med flera anläggningar. Under förutsättning att vissa villkor är uppfyllda kan kontrollanter inom en period på 36 månader besöka ett urval av anläggningar som är representativa för organisationens verksamhet och som möjliggör en tillförlitlig och trovärdig bedömning av organisationens övergripande miljöprestanda och efterlevnad av kraven i Emas-förordningen.

Denna urvalsmetod kan endast användas i samförstånd med miljökontrollanten och under förutsättning att kraven i punkt 2.4.3 är uppfyllda och att riktlinjerna för genomförandet i punkt 2.4.4 i denna användarhandledning har följts.

När en organisation begär att få tillämpa urvalsmetoden ska kontrollanten därför kontrollera följande för att kunna besluta om det är lämpligt att använda en urvalsmetod:

Organisationen uppfyller kraven i punkt 2.4.3 i denna användarhandledning.

Riktlinjerna för genomförandet i punkt 2.4.4 har följts.

Miljökontrollanten kan dessutom besluta att begränsa urvalsförfarandet om särskilda omständigheter innebär att urvalet av anläggningar inte kan ge tillräckligt förtroende för ledningssystemets effektivitet. Miljökontrollanterna bör fastställa sådana begränsningar på grundval av följande:

Miljöförhållanden eller andra relevanta omständigheter som är kopplade till organisationen.

Variationer i det lokala genomförandet av ledningssystemet för att hantera särskilda förhållanden vid de olika anläggningarna.

Organisationens tidigare efterlevnad (t.ex. enligt tillsynsmyndigheternas dokumentation av fall av bristande efterlevnad, antalet klagomål och utvärderingen av korrigerande åtgärder).

I sådana fall bör kontrollanten dokumentera de särskilda skälen för att begränsa organisationers möjlighet att använda ett urvalsförfarande.

Miljökontrollanten ska även utvärdera transparensen i grupperingen av liknande anläggningar enligt punkt 2.4.3.2 och grupperingens effekter på miljöredovisningens innehåll och på organisationens övergripande miljöprestanda. Resultaten och slutsatserna av denna utvärdering ska dokumenteras i kontrollrapporten.

Miljökontrollanten ska föra detaljerad dokumentation över varje ansökan om användning av urvalsmetoden för organisationer med flera anläggningar, som ger en motivering för urvalsmetoden och de använda parametrarna/kriterierna, och som visar att urvalsförfarandet sker i enlighet med det här dokumentet.

6.

Om det under kontrollförfarandet upptäcks fall av avvikelse eller bristande regelefterlevnad i en organisation med flera anläggningar där urvalsmetoden har tillämpats ska kontrollanten

undersöka i vilken utsträckning denna avvikelse eller bristande regelefterlevnad är anläggningsspecifik eller om andra anläggningar kan ha påverkats,

ålägga organisationen att identifiera alla anläggningar som kan ha påverkats, att vidta nödvändiga korrigerande åtgärder inom dessa anläggningar och att anpassa ledningssystemet om kontrollanten har indikationer på att avvikelsen eller den bristande regelefterlevnaden kan tyda på en brist i det övergripande ledningssystemet som kan påverka andra anläggningar. I fall av avvikelse eller bristande regelefterlevnad som inte kan korrigeras genom att man vidtar korrigerande åtgärder i tid bör kontrollanten rapportera till det behöriga organet att organisationen i fråga måste avregistreras tillfälligt eller permanent från Emas-registret,

kräva belägg för dessa åtgärder och kontrollera deras effektivitet genom att utvidga urvalet till ytterligare anläggningar så snart de korrigerande åtgärderna har vidtagits, och

validera miljöredovisningen och underteckna deklarationen om kontroll och godkännande i enlighet med bilaga VII till förordningen först när kontrollanten är förvissad om att beläggen för att alla anläggningar uppfyller kraven i Emas-förordningen och alla rättsliga krav som avser miljön.

7.

Vid den första kontrollen ska kontrollanten åtminstone kontrollera att organisationen uppfyller följande krav:

a)

Att det finns ett fullt fungerande miljöledningssystem.

b)

Att det finns ett fullt inplanerat revisionsprogram.

c)

Att ledningens genomgång har slutförts.

d)

Om organisationen vill använda en urvalsmetod för kontroll av sina anläggningar: att bestämmelserna i punkterna 2.4.3 och 2.4.4 i denna användarhandledning följs.

e)

Att det har utarbetats en miljöredovisning enligt Emas-förordningen och att sektorspecifika referensdokument i tillämpliga fall har beaktats.

2.4.3    Krav för användning av en urvalsmetod för kontroll av organisationer med flera anläggningar

2.4.3.1   Allmänna principer

För organisationer med flera anläggningar kan det vara lämpligt att tillämpa en urvalsmetod för att anpassa kontrollinsatserna utan att äventyra förtroendet för ledningssystemets regelefterlevnad och fullständiga genomförande så att kontinuerliga förbättringar av miljöprestanda vid varje anläggning som omfattas av Emas-registreringen kan uppnås.

Om det är lämpligt enligt de kriterier som anges i punkt 2.4.3.2, och på organisationens begäran, kan miljökontrollanterna samtycka till användning av en urvalsmetod för att kontrollera organisationer med flera anläggningar.

2.4.3.2   Behörighetskriterier för organisationer

a)

Urvalsförfaranden i en organisation med flera anläggningar kan endast tillämpas på grupper av liknande anläggningar.

b)

Anläggningarnas likhet ska bestämmas utifrån belägenhet i samma medlemsstat, samma typ av verksamhet, samma förfarande, samma rättsliga krav, liknande miljöaspekter och miljöpåverkan, miljöpåverkan med jämförbar betydelse och liknande miljöledning och kontrollmetoder.

c)

Grupp(er) av liknande anläggningar ska i samförstånd med miljökontrollanten fastställas som en del av miljöledningssystemet. Dessa grupper ska återspeglas i internrevisionerna och i ledningens översyn och ska anges i miljöredovisningen.

d)

Alla anläggningar som på grund av bristande likhet inte ingår i en grupp ska uteslutas från urvalförfarandet och kontrolleras individuellt.

e)

Alla anläggningar som omfattas av Emas-registreringen ska stå under direkt kontroll och ledning av organisationen.

f)

Miljöledningssystemet ska kontrolleras och administreras centralt och vara föremål för den centrala ledningens genomgång. Alla anläggningar som omfattas av Emas-registreringen ska ingå i organisationens miljöledningssystem och interna revisionsprogram och de ska alla ha granskats internt (inbegripet granskning av regelefterlevnad) före den första registreringen.

Organisationen måste också visa sin auktoritet och förmåga att inleda organisatoriska förändringar i alla anläggningar som omfattas av Emas-registreringen, om så krävs för att uppnå miljömål. Organisationen måste också visa sin förmåga att samla in och analysera data (inklusive men inte begränsat till de punkter som anges nedan) från alla anläggningar inklusive huvudkontoret:

Alla aspekter som ingår i miljörevisionen enligt bilaga I till Emas-förordningen (förordning EG nr 1221/2009), vilket bland annat inbegriper identifiering av de tillämpliga lagstadgade kraven, miljöaspekterna eller därtill kopplade effekter samt praxis och förfaranden för miljöledning.

Dokumentation om miljöledningssystemet och om förändringar av systemet.

Internrevision och utvärdering av resultaten, inklusive utvärdering av efterlevnaden av rättsliga krav som rör miljön.

Ledningens genomgång.

Miljöprestanda.

Klagomål.

Utvärdering av korrigerande åtgärder.

g)

Urval ska inte tillämpas för

organisationer till vilka incitament har beviljats på grundval av kravet att kontrollera alla anläggningar inom en kontrollcykel,

anläggningar belägna i tredjeländer,

anläggningar för vars verksamhet väsentligt annorlunda rättsliga miljökrav gäller,

anläggningar som omfattas av lagstiftning som reglerar utsläpp av förorenande ämnen, farligt avfall eller användning eller lagring av farliga ämnen (t.ex. Europaparlamentets och rådets direktiv 2010/75/EU (30) [direktivet om industriutsläpp] eller Europaparlamentets och rådets direktiv 2012/18/EU (31) [Sevesodirektivet]),

anläggningar som anger att risk för miljöolycka är en av deras betydande miljöaspekter.

Dessa anläggningar ska uteslutas från användning av urvalsmetoden och ska kontrolleras individuellt.

h)

Organisationen ska vara verksam inom de ekonomiska sektorer där användning av en urvalsmetod är tillåten enligt punkt 2.4.3.3.

2.4.3.3   Ekonomiska sektorer inom vilka användning av en urvalsmetod kan tillåtas

a)

Kontroll av organisationer med flera anläggningar med hjälp av en urvalsmetod är tillåtet inom följande sektorer:

Tabell 9

Ekonomiska sektorer inom vilka användning av en urvalsmetod är tillåten:

Ekonomisk sektor

Nace-kod

Finansiella tjänster utom försäkring och pensionsfondsverksamhet

64

Försäkring, återförsäkring och pensionsfondsverksamhet utom obligatorisk socialförsäkring

65

Juridisk och ekonomisk konsultverksamhet

69

Konsulttjänster till företag

70.2

Arbetsförmedling, bemanning och andra personalrelaterade tjänster (t.ex. personaladministration, tillfällig anställning, rekrytering)

78

Resebyrå- och researrangörsverksamhet och andra resetjänster och relaterade tjänster

79

Kontorstjänster

82.1

Förskola och låg- och mellanstadium

85.1 och 85.2

Bibliotek och arkiv

91

b)

Medlemsstaterna får genomföra pilotprojekt inom andra sektorer som anges i tabell 10 för att få erfarenheter av användning av en urvalsmetod. De ska för detta ändamål meddela följande information till Europeiska kommissionen:

En klar och entydig beskrivning av den organisation som ska registreras enligt Emas, inbegripet en kort beskrivning av organisationens sammanhang och en sammanfattning av dess verksamhet, produkter och tjänster samt, i förekommande fall, dess relation till eventuella moderorganisationer.

Förteckningen över anläggningar för vilka urval bör tillämpas.

Grupperna av anläggningar, inbegripet metoden för gruppering.

De anläggningar som omfattas av begränsningar för urval och motivering av begränsningen.

En beskrivning av alla betydande direkta och indirekta miljöaspekter som resulterar i betydande miljöpåverkan från organisationens sida och en förklaring av hur typen av påverkan förhåller sig till de betydande direkta och indirekta aspekterna samt en identifiering av betydande miljöaspekter som är förknippade med de anläggningar för vilka urval bör tillämpas.

De potentiella risker som är förknippade med dessa miljöaspekter.

Organisationens miljöpolicy och en kort beskrivning av organisationens miljöledningssystem, inbegripet dess övergripande och detaljerade miljömål satta i relation till de betydande miljöaspekterna och den betydande miljöpåverkan. Om organisationen ännu inte har infört något miljöledningssystem bör den beskriva det planerade miljöledningssystemet och dess huvudsakliga mål.

En hänvisning till de tillämpliga lagstadgade miljökraven.

Efter denna underrättelse informerar kommissionen Emas-kommittén om det planerade pilotprojektet och avger ett yttrande om dess lämplighet. Om en majoritet av medlemmarna i Emas-kommittén inte framför några invändningar inom två månader får pilotprojekt inledas enligt följande regler:

Organisationen följer alla krav i Emas-förordningen som gäller registrering eller förnyelse av registrering.

Urvalsmetoden bör fastställas i enlighet med de riktlinjer för genomförandet som beskrivs i punkt 2.4.4 i denna användarhandledning.

Pilotprojektet får inte pågå mer än tre år. Efter lyckat genomförande av ett pilotprojekt, inbegripet en positiv kontroll som bekräftar att organisationen uppfyller alla krav i Emas-förordningen, kan organisationen och dess anläggningar Emas-registreras i tre år, eller fyra år om undantaget i artikel 7 tillämpas.

En utvärdering av varje projekt ska redovisas till Emas-kommittén.

På grundval av utvärderingen av pilotprojektet kan Emas-kommittén rekommendera att inkludera sektorn i förteckningen över sektorer där användning av en urvalsmetod är tillåten (tabell 9).

Tabell 10

Ekonomiska sektorer inom vilka användning av en urvalsmetod kan tillåtas i pilotprojekt

Ekonomisk sektor

Nace-kod

Vattenförsörjning

36

Avloppsrening

37

Följande verksamheter som ingår i detaljhandel

Detaljhandel med brett sortiment (t.ex. stormarknader)

47.1

Specialiserad butikshandel med livsmedel, drycker och tobak

47.2

Specialiserad butikshandel med textilier

47.51

Specialiserad butikshandel med kultur- och fritidsartiklar

47.6

Specialiserad butikshandel med kläder

47.71

Specialiserad butikshandel med skodon och lädervaror

47.72

Specialiserad butikshandel med kosmetika och hygienartiklar

47.75

Specialiserad butikshandel med ur, guldsmedsvaror och smycken

47.77

Följande verksamheter som ingår i hotell- och restaurangverksamhet

Hotellverksamhet

55.1

Semesterbostäder och annan korttidsinkvartering

55.2

Restaurangverksamhet (men inte cateringverksamhet)

56.1

Barverksamhet

56.3

Dataprogrammering, datakonsultverksamhet o.d.

62

Fastighetsverksamhet: handel med och uthyrning av fastigheter (exklusive förvaltning av fastigheter)

68

Reklam och marknadsundersökning

73

Annan verksamhet inom juridik, ekonomi, vetenskap och teknik

74

Övergripande offentlig förvaltning

84.11

Gymnasial, eftergymnasial och övrig utbildning

85.3 , 85.4 , 85.5 , 85,6

Vård och omsorg med boende

87

Öppna sociala insatser

88

Konstnärlig och kulturell verksamhet samt nöjesverksamhet

90

Musei- och annan kulturverksamhet

91

Sportverksamhet

93.1

Intressebevakning; religiös verksamhet

94

2.4.4    Genomföranderiktlinjer för användning av en urvalsmetod för kontroll av organisationer med flera anläggningar

2.4.4.1   Allmänna principer

a)

Organisationen ska utarbeta en tydlig beskrivning av i vilken omfattning urvalsmetoden är tänkt att tillämpas (antalet anläggningar, en förteckning över alla anläggningar som omfattas och en kort beskrivning av deras verksamhet, samt en angivelse av de anläggningar som uteslutits från urvalet).

b)

De anläggningar som organisationer föreslår ska omfattas av urvalsmetoden ska delas upp i en eller flera grupper av liknande anläggningar på det sätt som anges i punkt 2.4.3.2 c i denna användarhandledning. Likheten mellan en grupp av anläggningar måste garantera att kontrollen av ett urval anläggningar kommer att vara i hög grad representativ för hela gruppen. Som anges i punkt 2.4.3.2 d ska alla anläggningar som inte ingår i en grupp på grund av bristande likhet uteslutas från urvalförfarandet och kontrolleras individuellt.

c)

Kontrollanten ska samtycka till den föreslagna omfattningen, fastställa karaktären hos varje grupp av anläggningar och utarbeta en kontrollplan som ska innehålla en beskrivning av den metod och de kriterier som används för att fastställa grupper av anläggningar, den metod som ska användas för att välja ut anläggningarna (för både de slumpmässiga och de icke-slumpmässiga delarna) samt tidpunkten för kontrollen. Denna kontrollplan ska även omfatta centrala verksamheter och processer för varje grupp av anläggningar, de betydande miljöaspekter som är förknippade med varje grupp av anläggningar, och en uppskattning av risknivåer för miljöolyckor som är förknippade med dessa aspekter.

2.4.4.2   Urvalsmetoden

Urvalsmetoden för att välja ut anläggningar för besök på plats inom de olika grupperna av anläggningar ska uppfylla följande krav:

a)

Ett representativt urval ska göras från varje grupp av liknande anläggningar.

b)

Urvalet ska delvis vara selektivt grundat på de faktorer som anges nedan och delvis icke-selektivt (slumpmässigt), och ska resultera i ett representativt urval av skilda anläggningar.

c)

Inom varje grupp ska minst 50 % av urvalet av anläggningar (avrundat till närmaste högre heltal) väljas slumpmässigt (icke-selektivt). Miljökontrollanten ska dokumentera det förfarande som använts för att göra detta slumpmässiga urval.

d)

Metoden för den återstående selektiva delen av urvalet ska uppfylla följande krav: Metoden ska säkerställa att skillnaderna mellan de utvalda anläggningarna är så stor som möjligt och ska omfatta åtminstone följande aspekter:

Resultaten av miljöutredningen och interna granskningar av anläggningar eller tidigare kontroller.

Dokumentation av incidenter, klagomål och andra relevanta aspekter av korrigerande och förebyggande åtgärder.

Betydande variation i anläggningsstorlek.

Variationer och komplexitet i ledningssystemet och ledningsprocesserna vid anläggningarna.

Förändringar sedan den senaste kontrollen.

Ledningssystemets mognad och kunskap om organisationen.

Skillnader i kultur, språk och lagstadgade krav.

Geografisk spridning.

Kontrollanten ska beakta dessa förhållanden och sträva efter att urvalet i möjligaste mån ska omfatta anläggningar som ännu inte har kontrollerats.

e)

Minimiantalet anläggningar som bör ingå i det urval som görs från varje grupp av anläggningar erhålls genom följande formel:

För den första Emas-registreringen och för förnyelse av registrering ska detta antal vara kvadratroten av antalet anläggningar som ingår i en grupp, multiplicerat med 2 och avrundat till närmaste högre heltal (t.ex. för en grupp om 100 anläggningar: √100 × 2 = 20).

f)

Urvalets storlek bör ökas om miljökontrollantens analys av de anläggningar som omfattas av Emas-registreringen visar på särskilda omständigheter när det gäller exempelvis följande faktorer:

Anläggningarnas storlek och antal anställda (t.ex. mer än 50 anställda på en anläggning).

Komplexiteten och risken för heterogena grupper av anläggningar.

Variationer i miljöprestanda.

Variationer i arbetsmetoder och rapportering av miljöpåverkan.

Variationer i verksamheten.

Betydelsen och omfattningen av miljöaspekter och förknippad miljöpåverkan.

Dokumentation av klagomål och andra relevanta aspekter av korrigerande och förebyggande åtgärder.

Resultat av interna revisioner och ledningens genomgång.

Exempel på kontroll av en organisation med flera anläggningar med hjälp av en urvalsmetod:

Ta exempelvis ett detaljhandelsföretag för kläder med följande anläggningar:

100 butiker > 150 m2

400 butiker < 150 m2

3 lager med olika storlek och innehåll

1 huvudkontor

1.

Gruppering av anläggningar för tillämpning av urvalsmetoden:

Grupp 1: 100 butiker > 150 m2

Grupp 2: 400 butiker < 150 m2

Enskilda anläggningar:

3 lager

1 huvudkontor

2.

Kontroll före den första registreringen:

Alla enskilda anläggningar (3 lager, 1 huvudkontor)

Grupp 1: minst √100 butiker × 2 = 20 butiker

Grupp 2: minst √400 butiker × 2 = 40 butiker

3.

Kontroll före förnyelse av registrering:

Alla enskilda anläggningar bör besökas

Grupp 1: minst √100 butiker × 2 = 20 butiker

Grupp 2: minst √400 butiker × 2 = 40 butiker

2.4.5    Dokumentation i miljöredovisningen av motiveringen för urvalsstorlek och urvalsmetoder

De Emas-registrerade organisationer för vilka miljökontrollanten har använt en urvals-/kontrollplan, såsom anges i punkt 2.4.3 i denna användarhandledning, ska dokumentera denna urvalsplan i sin miljöredovisning. I miljöredovisningen bör organisationen (kortfattat) klargöra resonemanget bakom valet av metod för att gruppera anläggningar och urvalets storlek. Miljöredovisningen ska innehålla en förteckning över alla anläggningar och tydligt skilja mellan besökta och obesökta anläggningar.

2.5   REGISTRERINGSFÖRFARANDE

Emas III-förordningen innehåller vissa allmänna regler om registrering. Medlemsstaterna får anpassa dessa i sin egen miljölagstiftning.

När systemet har genomförts och kontrollerats och miljöredovisningen har godkänts är organisationens nästa steg att ansöka om registrering hos behörigt organ.

2.5.1    Vilket behörigt organ ska organisationen vända sig till?

Tabell 11

Behöriga organ  (32) för olika typer av registrering

Olika situationer

Registreringsorgan

Organisation med en anläggning i EU

Det behöriga organ som officiellt utsetts av den medlemsstat där organisationen är belägen.

Organisation med flera anläggningar inom en och samma medlemsstat (federal stat eller liknande)

Det behöriga organ som utsetts av medlemsstaten för detta ändamål.

Registrering av organisationer med flera anläggningar i flera EU-medlemsstater (företagsregistrering inom EU)

När det gäller företagsregistrering i EU är sätet för organisationens huvudkontor eller ledningscentral (i den ordningen) avgörande när det ska fastställas vilket som är det ledande behöriga organet.

Registrering av organisationer med en eller flera anläggningar i tredjeländer (registrering av tredjeländer)

Om en medlemsstat väljer att tillhandahålla registrering av tredjeländer i enlighet med artikel 3.3 i Emas-förordningen är registreringen i den specifika medlemsstaten i praktiken beroende av tillgången på ackrediterade kontrollanter. Den potentiella kontrollanten bör ackrediteras i den specifika medlemsstat som tillhandahåller registrering av tredjeländer, för det specifika tredjelandet och för den specifika näringsgrenen (vilket baseras på Nace-koderna).

Registrering av en organisation med flera anläggningar i medlemsstater och i tredjeländer (global registrering)

I vilken medlemsstat det behöriga organ som ansvarar för förfarandet ligger fastställs utifrån följande villkor som rangordnas i följande ordning:

1.

När organisationen har huvudkontor som är beläget i en medlemsstat som tillhandahåller registrering av tredjeländer bör ansökan lämnas till det behöriga organet i den medlemsstaten.

2.

Om organisationens huvudkontor inte är beläget i någon medlemsstat som tillhandahåller registrering av tredjeländer men har sin ledningscentral där, bör ansökan lämnas till det behöriga organet i den medlemsstaten.

3.

Om den organisation som ansöker om global registrering varken har huvudkontor eller ledningscentral i någon medlemsstat som tillhandahåller registrering av tredjeländer måste organisationen inrätta en tillfällig ledningscentral i en medlemsstat som tillhandahåller registrering av tredjeländer och ansökan bör lämnas till det behöriga organet i den medlemsstaten.

Anm.:

Om mer än en medlemsstat omfattas av ansökan måste samordningsförfarandet mellan de berörda behöriga organen enligt avsnitt 3.2 (i handledningen för företagsregistrering i EU och tredjeland samt global registrering enligt förordning (EG) nr 1221/2009) följas. I så fall kommer det behöriga organet att fungera som ledande behörigt organ när det gäller de delar som rör företagsregistrering i EU i detta förfarande.

Anm.: När det gäller registrering kan de relevanta strukturerna skilja sig från en medlemsstat till en annan. I regel finns det ett behörigt organ per medlemsstat. I vissa medlemsstater är det dock vanligt att ha olika behöriga organ på regional nivå.

2.5.2    Dokument och/eller krav på registrering

Ansökan måste lämnas på det officiella språket i den medlemsstat där organisationen vill registreras. Den måste innehålla följande:

1.

En godkänd miljöredovisning enligt Emas (elektronisk eller tryckt version).

2.

En deklaration som undertecknats av miljökontrollanten som bekräftar att kontroll och godkännande har skett i enlighet med förordningen (bilaga VII till förordningen).

3.

Ett ifyllt ansökningsformulär (bilaga VI till förordningen) med information om organisationen, anläggningar och miljökontrollanten.

4.

Kvitto på betalda avgifter, om tillämpligt.

2.5.3    Villkor som ska uppfyllas före/under Emas-registreringen

1.

Kontroll och godkännande i enlighet med förordningen.

2.

Ett ifyllt ansökningsformulär, tillsammans med alla styrkande handlingar.

3.

Det behöriga organet ska på grundval av faktaunderlaget vara övertygat om att det inte finns några belägg för överträdelse av lagstadgade miljökrav. Lämpligt faktaunderlag kan vara en skriftlig rapport från tillsynsmyndigheten om att det inte finns några tecken på en sådan överträdelse.

4.

Inga relevanta klagomål från intressenter; eller att klagomål har lösts på ett tillfredsställande sätt.

5.

Det behöriga organet ska på grundval av faktaunderlaget vara övertygat om att organisationen uppfyller alla kraven i förordningen.

6.

Det behöriga organet har mottagit erforderlig avgift, om tillämpligt.

Det anses vara bästa praxis att ett behörigt organ fattar det slutgiltiga beslutet om Emas-registreringen för en ansökande organisation inom tre månader efter det att organisationen inkommit med en fullständig ansökan. Längre handläggningstid kan anses vara motiverat endast i undantagsfall.

2.5.4    Tillfällig eller permanent avregistrering av organisationer

Detta kan förekomma i följande fall:

Om ett behörigt organ har skäl att tro att en organisation inte uppfyller kraven i förordningen.

Om ett behörigt organ tar emot en skriftlig tillsynsrapport från ackrediterings- eller licensieringsorganet som visar att miljökontrollanten inte har fullgjort sina skyldigheter enligt denna förordning.

Om en organisation underlåter att inom två månader efter begäran lämna något av följande dokument till det behöriga organet: Den godkända miljöredovisningen, en uppdaterad miljöredovisning eller en deklaration om kontroll och godkännande som undertecknats av kontrollanten (bilaga VII) och ansökningsformuläret (bilaga VI).

Om ett behörigt organ får kännedom om en överträdelse av lagstadgade miljökrav genom en skriftlig rapport från tillsynsmyndigheten.

Det behöriga organet får inte häva den tillfälliga avregistreringen förrän det får betryggande information om att organisationen uppfyller kraven i förordningen.

I Emas-förordningen anges inte hur lång en tillfällig avregistrering är och det är därför upp till respektive behörigt organ att bestämma detta. Den bör dock inte vara längre än tolv månader.

Figur 10

Emas pelare. Registreringsförfarande

Image

2.6   VÄSENTLIGA ÄNDRINGAR

En organisation som gör ändringar när det gäller verksamhet, struktur, administration, rutiner, åtgärder, produkter eller tjänster måste ta hänsyn till ändringarnas miljöpåverkan eftersom de kan påverka Emas-registreringens giltighet. Mindre ändringar kan införlivas men väsentliga ändringar innebär att miljöutredningen, miljöpolicyn, miljöprogrammen, miljöledningssystemet och miljöredovisningen måste uppdateras. Alla uppdaterade dokument måste kontrolleras och godkännas inom sex månader. Efter godkännandet måste organisationen överlämna ändringarna till det behöriga organet med hjälp av formuläret i bilaga VI till förordningen.

Figur 11

Flödesschema över hanteringen av väsentliga ändringar enligt Emas

Image

3.   ANVÄNDNING AV EMAS-LOGOTYPEN

Vad är Emas-logotypen?

Emas-logotypen är en grafisk bild som förknippas med följande:

Ett korrekt genomförande av Emas-ordningen.

Ett åtagande om att göra kontinuerliga förbättringar.

Ett aktivt arbetstagarinflytande.

Trovärdig information om organisationens miljöprestanda.

Bevisad regelefterlevnad.

Emas-logotypen är ett bra sätt att visa att organisationen är miljövänlig.

3.1   HUR EMAS-LOGOTYPEN SKA ANVÄNDAS

Endast organisationer med en giltig Emas-registrering får använda Emas-logotypen.

Organisationens registreringsnummer måste alltid anges i logotypen, förutom vid marknadsföring och reklam för Emas-ordningen.

Endast den officiella logotypen är giltig.

Om organisationen har flera anläggningar och alla inte ingår i registreringen får den endast använda logotypen för registrerade anläggningar och får inte ge intryck av att hela organisationen är registrerad.

Miljöredovisningen bör helst vara försedd med logotypen.

Figur 12

Emas-logotypen

Image

Användning av Emas-logotypen vid marknadsföring och reklam för ordningen

Emas-logotypen får användas utan registreringsnummer endast för detta ändamål. Behöriga organ, ackrediterings- och licensieringsorgan och andra berörda parter får använda logotypen.

3.2   HUR EMAS-LOGOTYPEN INTE FÅR ANVÄNDAS

På produkter eller förpackningar, för att undvika sammanblandning med produktmärken.

Tillsammans med jämförande påståenden om andra verksamheter och tjänster.

Logotypen får inte användas på ett sätt som kan leda till sammanblandning med andra märken för produkter eller tjänster.

Tabell 12

Användningen av Emas-logotypen: Exempel

Nr

Exempel eller ändamål

Tillåten

1

Användningen av Emas-logotypen på en registrerad organisations brevpapper, kuvert, visitkort, företagsuniform, företagsdator, väska, Emas-flagga och andra liknande användningsområden, i marknadsföring och reklam på företagsnivå.

JA, tillsammans med registreringsnummer, eftersom det avser marknadsföring av en Emas-registrerad organisation.

2

Logotyp i sidhuvudet på dokument som lämnas till myndigheter och innehåller godkända uppgifter om organisationens prestanda.

JA, tillsammans med registreringsnummer.

3

Logotyp på en folder som innehåller en rapport om en delvis registrerad organisation.

JA, tillsammans med registreringsnummer, men endast registrerade anläggningar får anges i logotypen.

4

Logotyp på en produkt med budskapet ”ekologisk produkt”.

NEJ, den kan sammanblandas med miljömärken för produkter.

5

Logotyp i en ombordtidskrift på ett registrerat flygbolag, tillsammans med viss godkänd information.

JA, tillsammans med registreringsnummer.

6

Logotyp på ett flygplan, ett tåg, en buss, en firmabil eller -lastbil, eller på ett tunnelbanetåg som tillhör ett Emas-registrerat företag.

JA, tillsammans med registreringsnummer.

7

Logotyp placerad på ett registrerat distributionsföretags lastbil tillsammans med företagets namn och ett godkänt påstående, t.ex. ”Vi har minskat den genomsnittliga dieselförbrukningen i vår lastbilsflotta med 20 % till x liter per 100 km mellan 2009 och 2012”.

JA, tillsammans med registreringsnummer.

8

Logotyp stämplad på ett fotografi av ett oregistrerat boende för turister i en katalog för en registrerad resebyrå.

NEJ, användningen av logotypen är förvirrande. Den får endast användas av resebyrån.

9

Logotyp stämplad i en katalog för en registrerad resebyrå med godkänd information om hållbara turismåtgärder som genomförs av organisationen.

JA, tillsammans med registreringsnummer.

10

Logotyp placerad på en intern kommuniké till anställda som enbart innehåller godkänd information om driften av miljöledningssystemet.

JA, registreringsnummer behöver inte anges i logotypen eftersom det är ett internt meddelande för allmänna informationsändamål.

11

Logotyp på nyhetsbrev eller på omslaget till en broschyr till kunder och leverantörer, där innehållet har hämtats ur den godkända miljöredovisningen.

JA, tillsammans med registreringsnummer, eftersom det är ett meddelande till allmänheten, med konkreta exempel från ett specifikt Emas-registrerat företag, från den registrerade organisationen.

12

Logotyp i den årliga miljörapporten från ett företag med både registrerade och oregistrerade anläggningar som är placerad överst i kapitlet om den godkända miljöredovisningen i vilket organisationens Emas-registrerade anläggningar är tydligt identifierbara.

JA, tillsammans med registreringsnummer. Om registreringen är en företagsregistrering där flera anläggningar är registrerade under samma nummer måste detta nummer användas. Om alla Emas-anläggningar är registrerade var för sig måste de enskilda anläggningarnas registreringsnummer framgå.

13

Logotyp som underliggande grafik till en sammanställning av godkända miljöuppgifter i en företagsrapport.

JA, tillsammans med registreringsnummer.

14

En allmän broschyr för en statlig organisation som handlar om hur Emas-registrerade organisationer i allmänhet bäst kan återvinna eller bearbeta olika delar av sitt avfall.

JA, utan registreringsnummer, eftersom broschyren är avsedd att öka medvetenheten generellt och därför inte är kopplad till något registreringsnummer.

15

Logotyp tillsammans med godkänd miljöinformation om en organisations webbplats.

JA, tillsammans med registreringsnummer.

16

Logotyp på den registrerade organisationens utställningsmonter som används för att marknadsföra den registrerade organisationen som sådan.

JA, tillsammans med registreringsnummer.

17

Logotyp på en registrerad organisations utställningsmonter men som används för att marknadsföra Emas som miljöledningssystem i allmänhet.

JA, registreringsnummer behöver inte anges i logotypen eftersom den används för marknadsföringsändamål.

18

Logotyp i en dagstidning, som underliggande grafik i en gemensam annons för två företag som meddelar sitt miljösamarbete i leveranskedjan (ett är registrerat, det andra är det inte).

NEJ, det är förvirrande, eftersom en av organisationerna inte är registrerad.

19

Logotyp utan registreringsnummer som används för marknadsföringsändamål av en oregistrerad organisation.

JA, men endast för Emas-relaterad marknadsföring och inte för marknadsföring av själva organisationen.

20

Logotyp på biljetter från en registrerad kollektivtrafikorganisation.

JA, registreringsnummer behöver inte anges i logotypen om den används för att marknadsföra Emas generellt. Om logotypen på biljetterna används för att marknadsföra en specifik Emas-registrerad organisation måste registreringsnumret för den specifika organisationen anges i logotypen.

4.   HANTERING AV ÖVERGÅNG FRÅN ANDRA MILJÖLEDNINGSSYSTEM TILL EMAS

Det finns ett ökande antal miljöledningssystem över hela EU som är avsedda att tillgodose de behov som finns inom specifika verksamhetsområden eller sektorer. Lokala eller regionala förvaltningar kan använda sådana system för att öka hållbarheten eller miljöprestandan. De mest relevanta av dessa system kan nås via en länk i en bilaga till denna handledning.

I Emas-förordningen nämns möjligheten att bedöma överensstämmelsen mellan förordningen och andra system. Ett officiellt erkännande av vissa eller alla delar av andra miljöledningssystem kan underlätta organisationens övergång till Emas. Förfarandet ser ut på följande sätt:

a)

Medlemsstaterna måste till kommissionen överlämna en skriftlig begäran om erkännande av hela eller delar av miljöledningssystemet.

b)

Medlemsstaterna ska i sin begäran analysera och specificera de relevanta delarna av miljöledningssystemet och motsvarande delar i Emas-förordningen och styrka att de överensstämmer med Emas-förordningen.

c)

Kommissionen överlämnar förslaget till Emas-kommittén (som inrättats i enlighet med artikel 49 i förordningen).

d)

Uppgifter om det erkända miljöledningssystemet, eller delar av det, ska offentliggöras i Europeiska unionens officiella tidning när kommissionen har godkänt dem.

Organisationer som har genomfört ett erkänt miljöledningssystem, eller delar av det, behöver inte upprepa de delar som redan har erkänts när de övergår till Emas.

Varje medlemsstat har sina egna förfaranden för att hantera ansökningar om erkännande. Det behöriga organet kan ge mer information om detta.

5.   EMAS III FÖR SMÅ OCH MEDELSTORA FÖRETAG

Små organisationer:

a)

mikroföretag samt små och medelstora företag enligt definitionen i kommissionens rekommendation 2003/361/EG av den 6 maj 2003, eller

b)

lokala myndigheter vars förvaltning omfattar mindre än 10 000 invånare eller andra offentliga myndigheter som har färre än 250 anställda och en årlig budget på högst 50 miljoner euro, eller en balansomslutning som inte överstiger 43 miljoner euro per år, däribland alla följande:

c)

Statliga eller andra offentliga förvaltningar, eller offentliga rådgivande organ på nationell, regional eller lokal nivå.

d)

Fysiska eller juridiska personer som har offentliga förvaltningsuppgifter enligt nationell lagstiftning, inbegripet särskilda uppgifter, verksamheter eller tjänster som rör miljön.

e)

Fysiska eller juridiska personer som har offentligt ansvar eller offentliga uppgifter eller som tillhandahåller offentliga tjänster som rör miljön under överinseende av ett organ eller en person som avses i led b.

Period för kontroll och intern revision

Små och medelstora företag kan välja att göra den fullständiga kontrollen på fyra år i stället för tre. Tidsperioden för intern revision kan också förlängas från ett år till två. Detsamma gäller för miljöredovisningen. Organisationen måste ändå vidarebefordra den icke-godkända uppdaterade miljöredovisningen till det behöriga organet varje år.

För att utnyttja denna möjlighet måste organisationen ansöka hos det behöriga organet som kan förlänga den tillåtna tidsperioden om kontrollanten har bekräftat att villkoren i artikel 7 är uppfyllda:

Att det inte föreligger några betydande miljörisker.

Att det inte har skett några väsentliga ändringar i organisationen.

Att organisationen inte bidrar till några betydande lokala problem.

Kontroll och godkännande

Miljökontrollanterna bör ta hänsyn till små organisationers särdrag för att undvika att belasta dem i onödan. Små och medelstora företag har ofta knappa resurser och medel och har därför inte samma kapacitet att klara omfattande rapportering och utdragna förfaranden. Kontrollanten bör även ta hänsyn till andra särdrag hos små och medelstora företag, till exempel personal med flera funktioner, utbildning på arbetsplatsen och förmågan att snabbt anpassa sig till förändringar. Det främsta målet är att objektivt visa att Emas-systemet är effektivt och att rutinerna står i proportion till verksamhetens storlek och komplexitet, personalens kompetens och typen av miljöpåverkan.

Avgifter

Det är upp till varje medlemsstat att fastställa avgifter för Emas-registreringen. Vissa medlemsstater tar inte ut någon avgift. Oavsett vilket står det i förordningen att avgifterna måste vara rimliga och stå i proportion till organisationens storlek.

Tekniskt och finansiellt stöd

Tekniskt och finansiellt stöd till Emas-ordningen i allmänhet, och till små och medelstora företag i synnerhet, måste ges på två nivåer. Medlemsstaterna måste tillhandahålla information om lagstadgade krav och tillsynsmyndigheter, samt teknisk information om ackrediterade eller licensierade kontrollanter, registreringsförfaranden, bidrag och finansiellt stöd. Kommissionen tillhandahåller information och underlättar för organisationer som vill registrera sig i Emas genom att erkänna delar av andra miljöledningssystem eller genom att integrera Emas i annan EU-politik.

Emas enkla metod

Även om Emas enkla metod (33) inte nämns i förordningen bör den beaktas som ett verktyg som står till små organisationers förfogande. Den hjälper dem att genomföra alla Emas-kraven snabbt, billigt och enkelt.

Grupper och stegvis ansats

Lokala myndigheter, i samarbete med handelskamrar, näringslivsorganisationer m.fl., kan ge stöd till små och medelstora företag som vill genomföra Emas genom att möjliggöra en gruppvis och stegvis ansats.

En ”grupp” är ett sätt att genomföra Emas som grupp, vilket är lämpligt för organisationer som är verksamma i samma sektor eller belägna i samma geografiska område. De kan genomföra Emas gemensamt och sedan gå vidare och registrera sig var för sig.

Den stegvisa ansatsen kan skräddarsys efter behoven i varje medlemsstat. Den kan till exempel kopplas till allmänna projekt eller planer, för att främja genomförandet av Emas i en kommun eller inom ett område där olika enheter planerar att uppmuntra organisationer att genomföra god miljöpraxis i olika faser eller på olika sätt.

Exempel: Ett bra exempel på denna ansats kan vara att ta en grupp små och medelstora företag i ett industriområde eller i en region som leds av kommunen i samarbete med en handelskammare och näringslivsorganisationer som är verksamma i området. De inblandade organisationerna kan delta i en stegvis genomförandeplan för Emas. Det första steget skulle vara att underlätta för alla företag att göra en miljöutredning enligt Emas. Det andra steget skulle vara att utforma och genomföra god förvaltning. Det tredje steget skulle vara att upprätta ett formellt miljöledningssystem, till exempel EN ISO 14001. Slutligen skulle företagen kunna välja Emas som huvudledningssystem.

Detta koncept skulle kunna utgöra en möjlighet att utarbeta marknadsföringsplaner i grupper av organisationer, i vissa sektorer eller inom specifika territorier där det finns ett intresse av att främja genomförandet av miljöledningssystem, formella eller informella, innan Emas slutligen genomförs fullt ut.

BILAGA II

Mer Emas-relaterad information som kan användas tillsammans med denna användarhandledning finns på kommissionens Emas-webbsidor på http://ec.europa.eu/environment/emas/ där du kan hitta följande:

Förordning (EG) nr 1221/2009 av den 25 november 2009 – http://eurlex.europa.eu/LexUriServ/LexUriServ.do?uri=OJ:L:2009:342:0001:0045:SV:PDF

Meddelande från kommissionen – Fastställande av arbetsplanen som fastställer en vägledande förteckning över sektorer för antagande av sektorsvisa och sektorsövergripande referensdokument, enligt Emas-förordningen – http://eur-lex.europa.eu/legal-content/EN/TXT/?uri=CELEX%3A52011XC1208%2801%29

Emas sektorspecifika referensdokument för de prioriterade sektorer som identifierats – http://ec.europa.eu/environment/emas/emas_publications/sectoral_reference_documents_en.htm

Faktablad om 20 miljöledningssystem (steg för steg mot Emas) – http://ec.europa.eu/environment/emas/emas_publications/publications_studies_en.htm#Step up to EMAS

Index över alla behöriga organ och ackrediterings- eller licensieringsorgan som är inblandade i Emas – http://ec.europa.eu/environment/emas/emas_contacts/competent_bodies_en.htm

Emas-dokument – http://ec.europa.eu/environment/emas/emas_publications_en.htm

Emas-faktablad om specifika frågor där man har konstaterat att det finns behov av mer detaljerad information: – http://ec.europa.eu/environment/emas/emas_publications/publications_studies_en.htm#Fact Sheets

Global Emas-registrering: Kommissionens beslut 2011/832/EU av den 7 december 2011 om en handledning för företagsregistrering i EU och tredjeland samt global registrering enligt Europaparlamentets och rådets förordning (EG) nr 1221/2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning (Emas) – http://eur-lex.europa.eu/legal-content/SV/TXT/?qid=1512397204091&uri=CELEX:32011D0832

http://ec.europa.eu/environment/emas/join_emas/emas_global_en.htm


(1)  Förordning (EG) nr 1221/2009.

(2)  Kommissionens beslut 2011/832/EU av den 7 december 2011 om en handledning för företagsregistrering i EU och tredjeland samt global registrering enligt Europaparlamentets och rådets förordning (EG) nr 1221/2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning (Emas) (EUT L 330, 14.12.2011, s. 25).

(3)  http://ec.europa.eu/environment/emas/emas_publications/publications_studies_en.htm#Study on the costs and benefits of EMAS to registered organisations

(4)  Direktivet om industriutsläpp, som upphäver direktivet om samordnade åtgärder för att förebygga och begränsa föroreningar från och med den 7 januari 2013, ger medlemsstaterna detaljerad vägledning om miljötillsyn, där tiden mellan två besök på plats ska baseras på en systematisk bedömning av miljöriskerna vid de berörda anläggningarna utifrån en rad kriterier, bland annat verksamhetsutövarens deltagande i Emas.

(5)  EVER-studien: Evaluation of EMAS and Eco-Label for their Revision (2005), IEFE – Università Bocconi för GD Miljö vid Europeiska kommissionen.

(6)  Hamschmidt J., Dyllick T. (2001), ”ISO 14001: profitable? Yes! But is it eco-effective?”, Greener Management International, nr 34.

(7)  CESQA SINCERT (2002), Indagine sulla certificazione ambientale secondo la norma UNI EN ISO 14001; risultati indagine Triveneto.

(8)  Freimann, Walther (2001), ”The impacts of corporate environmental management systems: a comparison of EMAS and ISO 14001”, Greener Management International, nr 36, s. 91–103.

(9)  IRIS (2000), Miljöledningssystem – papperstiger eller kraftfullt verktyg, Institutet för verkstadsteknisk forskning (IVF), Mölndal.

(10)  Uppgifterna i tabell 1 är preliminära och beroende av storlekskategorierna. De kan därför inte tillämpas direkt på alla organisationer i alla situationer.

(11)  Organisationsstorlek enligt definitionen i kommissionens rekommendation 2003/361/EG om definitionen av mikroföretag samt små och medelstora företag (EUT L 124, 20.5.2003, s. 36).

(12)  Små och medelstora företag kan ofta minska sina kostnader i samband med genomförandet av Emas det första året genom att använda Emas enkla metod. Det har nyligen gjorts uppskattningar som visar att kostnaderna för genomförandet under första året i vissa fall kan minskas till 11 500 euro för mikroorganisationer och 17 000 euro för små organisationer. Dessa uppskattningar är endast vägledande och bygger på uppgifter som lämnats av små och medelstora företag efter seminarier för små och medelstora företag i olika medlemsstater.

(13)  Små och medelstora företag kan ofta minska sina kostnader i samband med genomförandet av Emas det första året genom att använda Emas enkla metod. Det har nyligen gjorts uppskattningar som visar att kostnaderna i vissa fall kan minskas till 2 200 euro per år för mikroorganisationer och 3 300 euro per år för små organisationer. Dessa uppskattningar är endast vägledande och bygger på uppgifter som lämnats av små och medelstora företag efter seminarier för små och medelstora företag i olika medlemsstater.

(14)  http://ec.europa.eu/environment/emas/join_emas/what_if_i_am_an_sme_en.htm

(15)  EUT L 393, 30.12.2006, s. 1.

(16)  Den vägledande förteckningen över vilka elva sektorer som ska prioriteras vid utarbetandet av sektorspecifika referensdokument offentliggörs i kommissionens meddelande Fastställande av arbetsplanen som fastställer en vägledande förteckning över sektorer för antagande av sektorsvisa och sektorsövergripande referensdokument, enligt förordning (EG) nr 1221/2009 om organisationers frivilliga deltagande i gemenskapens miljölednings- och miljörevisionsordning (Emas) – ref. 2011/C 358/02 (EUT C 358. 8.12.2011, s. 2).

(17)  http://ec.europa.eu/environment/emas/join_emas/what_if_i_am_an_sme_en.htm

(18)  Enligt ett officiellt förfarande i enlighet med artikel 45 i Emas-förordningen.

(19)  I enlighet med artikel 10 och bilaga V i Emas-förordningen och avsnitt 3 i detta dokument.

(20)  Enligt bilaga IV (B.e) i Emas-förordningen ska miljöredovisningen innehålla en ”sammanfattning av tillgängliga uppgifter om organisationens miljöprestanda i relation till dess övergripande och detaljerade miljömål med avseende på dess betydande miljöpåverkan. Rapporteringen ska avse kärnindikatorer och andra befintliga indikatorer för miljöprestanda som kan vara av relevans, i enlighet med avsnitt C”. Följande anges i bilaga IV avsnitt C: ”Varje organisation ska även årligen rapportera om sin prestanda när det gäller de mer specifika miljöaspekter som identifierats i organisationens miljöredovisning, och i förekommande fall ta hänsyn till sektorspecifika referensdokument enligt artikel 46.”

(21)  Emas-förordningen är dock inte rätt plats att fastställa en metod eller ett verktyg för att utveckla en inventering och/eller en kvantifiering av utsläppen.

(22)  Enligt bilaga IV (B.e) i Emas-förordningen ska miljöredovisningen innehålla en ”sammanfattning av tillgängliga uppgifter om organisationens miljöprestanda i relation till dess övergripande och detaljerade miljömål med avseende på dess betydande miljöpåverkan. Rapporteringen ska avse kärnindikatorer och andra befintliga indikatorer för miljöprestanda som kan vara av relevans, i enlighet med avsnitt C”. Följande anges i bilaga IV avsnitt C: ”Varje organisation ska även årligen rapportera om sin prestanda när det gäller de mer specifika miljöaspekter som identifierats i organisationens miljöredovisning, och i förekommande fall ta hänsyn till sektorspecifika referensdokument enligt artikel 46.”

(*1)  Den officiella definitionen av bruttoförädlingsvärde återfinns i kommissionens förordning (EG) nr 1503/2006 av den 28 september 2006 om tillämpning och ändring av rådets förordning (EG) nr 1165/98 om konjunkturstatistik när det gäller variabeldefinitionerna, variabelförteckningen och frekvensen för sammanställning av data. Förädlingsvärdet till baspriser kan beräknas från omsättningen (exklusive moms och andra liknande avdragsgilla skatter som är direkt knutna till omsättningen), plus kapitaliserad produktion, plus andra rörelseintäkter plus eller minus lagerförändringar, minus inköp av varor och tjänster, minus andra varuskatter som är knutna till omsättningen men inte avdragsgilla, plus eventuella produktsubventioner. Inkomster och utgifter som klassificeras som finansiella eller extraordinära i företagets bokföring ingår inte i förädlingsvärdet. Produktsubventioner ingår således i förädlingsvärdet till baspriser, men däremot inga produktskatter. Förädlingsvärdet beräknas brutto, eftersom värdejusteringar (t.ex. avskrivningar) inte dras av.

Anm.: Miljöredovisningen enligt Emas-förordningen kan användas för att rapportera om specifika kärnindikatorer för prestanda, särskilt för energi och utsläpp av växthusgaser.

(23)  Europaparlamentets och rådets förordning (EG) nr 765/2008 av den 9 juli 2008 om krav för ackreditering och marknadskontroll i samband med saluföring av produkter och upphävande av förordning (EEG) nr 339/93 (EUT L 218, 13.8.2008, s. 30).

(24)  Hänvisningen till ”den här förordningen” i Emas-förordningen avser ”Emas-förordningen”.

(25)  http://ec.europa.eu/environment/emas/emas_registrations/register_en.htm

(26)  Europaparlamentets och rådets förordning (EG) nr 1893/2006 av den 20 december 2006 om fastställande av den statistiska näringsgrensindelningen Nace rev. 2 och om ändring av rådets förordning (EEG) nr 3037/90 och vissa EG-förordningar om särskilda statistikområden (EUT L 393, 30.12.2006, s. 1).

(27)  Med förbehåll för de tillsynskrav som ställs av ackrediterings- eller licensieringsorganet i den medlemsstat där kontrollanten vill verka, i enlighet med artikel 24 i Emas-förordningen.

(28)  Punkt A.9.1.2 ”Utvärdering av efterlevnad” i bilaga II till förordningen, och punkt A.10.2 ”Avvikelse och korrigerande åtgärd” i bilaga II till förordningen.

(29)  Artikel 13.2 c, och även kontrollera att det inte finns några relevanta klagomål från intressenter eller att klagomål har lösts på ett tillfredsställande sätt (artikel 13.2 d).

(30)  Europaparlamentets och rådets direktiv 2010/75/EU av den 24 november 2010 om industriutsläpp (samordnade åtgärder för att förebygga och begränsa föroreningar) (EUT L 334, 17.12.2010, s. 17).

(31)  Europaparlamentets och rådets direktiv 2012/18/EU av den 4 juli 2012 om åtgärder för att förebygga och begränsa faran för allvarliga olyckshändelser där farliga ämnen ingår och om ändring och senare upphävande av rådets direktiv 96/82/EG (EUT L 197, 24.7.2012, s. 1).

(32)  En förteckning över kontaktuppgifter till behöriga organ, ackrediteringsorgan eller miljökontrollanter i EU:s medlemsstater och Norge finns på följande webbsida: http://ec.europa.eu/environment/emas/emas_contacts/competent_bodies_en.htm

(33)  Mer information om Emas enkla metod finns påhttp://ec.europa.eu/environment/emas/join_emas/what_if_i_am_an_sme_en.htm


12.12.2017   

SV

Europeiska unionens officiella tidning

L 328/87


KOMMISSIONENS GENOMFÖRANDEBESLUT (EU) 2017/2286

av den 6 december 2017

om erkännande av att kraven för miljöledningssystemet Eco-Lighthouse uppfyller motsvarande krav i miljölednings- och miljörevisionsordningen (Emas) i enlighet med artikel 45 i Europaparlamentets och rådets förordning (EG) nr 1221/2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning

[delgivet med nr C(2017) 8082]

(Text av betydelse för EES)

EUROPEISKA KOMMISSIONEN HAR ANTAGIT DETTA BESLUT

med beaktande av fördraget om Europeiska unionens funktionssätt,

med beaktande av Europaparlamentets och rådets förordning (EG) nr 1221/2009 av den 25 november 2009 om frivilligt deltagande för organisationer i gemenskapens miljölednings- och miljörevisionsordning (Emas) och om upphävande av förordning (EG) nr 761/2001 och kommissionens beslut 2001/681/EG och 2006/193/EG (1), särskilt artikel 45,

efter att ha hört den kommitté som inrättats genom artikel 49 i förordning (EG) nr 1221/2009, och

av följande skäl:

(1)

Emas syftar till att främja en ständig förbättring av organisationers miljöprestanda genom att organisationerna inför och tillämpar ett miljöledningssystem, att dessa systems prestanda regelbundet utvärderas, att det informeras om miljöprestanda, att det förs en öppen dialog med allmänheten och andra intressenter och att de anställda i organisationerna engageras aktivt.

(2)

Organisationer som tillämpar andra miljöledningssystem och som vill övergå till Emas bör kunna göra detta på ett så enkelt sätt som möjligt. Kopplingar till andra miljöledningssystem bör övervägas för att underlätta införandet av Emas utan att behöva dubblera befintliga metoder och förfaranden.

(3)

För att underlätta genomförandet av Emas och undvika att dubblera metoder och förfaranden som baseras på andra miljöledningssystem som har certifierats enligt lämpliga förfaranden, ska de relevanta delar av andra miljöledningssystem som kommissionen har erkänt uppfyller motsvarande krav i Emas betraktas som överensstämmande med de kraven.

(4)

Detta erkännande bör baseras på en analys av kraven och förfarandena i dessa andra miljöledningssystem och av deras förmåga att uppnå samma mål som motsvarande krav i förordning (EG) nr 1221/2009.

(5)

Norge skickade en skriftlig begäran om erkännande av miljöledningssystemet Eco-Lighthouse till kommissionen den 26 januari 2016. Denna begäran har åtföljts av kompletterande upplysningar för att ge kommissionen de bevis som krävs för att bedöma huruvida de berörda delarna i miljöledningssystemet överensstämmer med Emas-kraven.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

Artikel 1

På grundval av de bevis som de norska myndigheterna har överlämnat erkänner kommissionen de delar i systemet Eco-Lighthouse som enligt bilagan till detta beslut uppfyller motsvarande krav i förordning (EG) nr 1221/2009.

Artikel 2

Förändringar i de krav i Eco-Lighthouse-systemet som påverkar detta erkännande ska rapporteras till kommissionen minst en gång per år. Om dessa krav eller kraven i förordning (EG) nr 1221/2009 ändras får kommissionen besluta att upphäva eller ändra detta beslut.

Artikel 3

Detta beslut riktar sig till medlemsstaterna.

Utfärdat i Bryssel den 6 december 2017.

På kommissionens vägnar

Karmenu VELLA

Ledamot av kommissionen


(1)  EUT L 342, 22.12.2009, s. 1.


BILAGA

Inledning

Genom Emas-förordningen (1) inrättas ett högkvalitativt ledningsverktyg som organisationer kan använda för att utvärdera, rapportera om och förbättra sin miljöprestanda på frivillig basis. Emas är öppen för alla organisationer som vill förbättra sin miljöprestanda. Ordningen omfattar alla ekonomiska sektorer och tjänstesektorer och kan tillämpas i hela världen.

Emas syftar till att främja en ständig förbättring av organisationers miljöprestanda genom att de inför och tillämpar ett miljöledningssystem, att dessa systems prestanda regelbundet utvärderas på ett systematiskt och objektivt sätt, att det informeras om miljöprestanda, att skapa en öppen dialog med allmänheten och engagera organisationernas anställda aktivt, samt tillhandahålla ändamålsenlig fortbildning.

Emas-förordningen säkerställer trovärdighet och öppenhet i miljöprestandan hos organisationer som är registrerade i Emas genom ett system med tredjepartskontroller som utförs av ackrediterade eller licensierade kontrollanter.

För att underlätta registreringen av organisationer som har infört andra miljöledningssystem och som vill gå över till Emas ska kommissionen enligt förordningen (2) erkänna andra nationella eller regionala miljöledningssystem, eller delar av dem, som är förenliga med motsvarande krav i förordningen, förutsatt att vissa villkor är uppfyllda.

Enligt artikel 45 i förordningen får medlemsstaterna lämna en skriftlig begäran till kommissionen om erkännande av att befintliga miljöledningssystem, eller delar av dessa, som certifierats i enlighet med lämpliga certifieringsförfaranden erkända på nationell eller regional nivå, uppfyller motsvarande krav i den förordningen.

Efter att ha granskat en sådan begäran ska kommissionen i enlighet med det rådgivande förfarande som avses i artikel 49.2 erkänna de relevanta delarna av miljöledningssystemen och erkänna ackrediterings- eller licensieringskraven för certifieringsorganen om den anser att en medlemsstat

i sin begäran tillräckligt tydligt har specificerat de relevanta delarna av miljöledningssystemen och de motsvarande kraven i förordningen,

har styrkt att alla relevanta delar av de berörda miljöledningssystemen överensstämmer med förordningen.

Konsekvens av erkännande: Enligt artikel 4.3 i förordningen ska organisationer som vill bli registrerade i Emas och som har ett certifierat miljöledningssystem som är erkänt i enlighet med artikel 45 inte vara skyldiga att utföra de delar som har erkänts som likvärdiga med förordningen.

Det bör dock påpekas att bestämmelserna i artikel 18 gäller vid kontrollen av förberedelserna för registrering i Emas och för förlängning av registreringen.

En kontrollant som är ackrediterad eller licensierad för Emas ska bedöma om de nödvändiga förfarandena, t.ex. organisationens miljöutredning, miljöpolicy, ledningssystem och revisionsförfaranden, samt genomförandet av dem, uppfyller förordningens krav. Delar av det andra miljöledningssystem som i enlighet med artikel 45 har erkänts uppfylla motsvarande krav i förordning (EG) nr 1221/2009 ska därför också kontrolleras, för att se till att genomförandet uppfyller de krav som har fastställts som likvärdiga i det berörda erkännandet.

Att t.ex. dokumentationsförfarandet i ett annat miljöledningssystem erkänns som likvärdigt utgör inget hinder för en kontroll av att förfarandet används korrekt, för att säkerställa att det omfattar den väsentliga information som krävs.

Direktivet om offentlig upphandling (3) innehåller också en hänvisning till detta erkännande. Enligt artikel 62.2 i direktivet är andra miljöledningssystem som har erkänts i enlighet med artikel 45 i förordning (EG) nr 1221/2009 en av de tre typer av intyg som upphandlande myndigheter kan hänvisa till när de kräver uppvisande av intyg om överensstämmelse med vissa miljöledningssystem eller miljöledningsstandarder i samband med ett upphandlingsförfarande.

Den 26 januari 2016 skickade Norge in en preliminär ansökan om erkännande enligt Emas-förordningen av sitt nationella miljöcertifieringssystem, stiftelsen Eco-Lighthouse (ELH). Ansökan har följts av kompletterande upplysningar för att tydligt beskriva kraven i Eco-Lighthouse-systemet och motsvarande krav i Emas-förordningen (inklusive bilagor) och ge kommissionen de bevis som krävs för att konstatera att de berörda delarna i miljöledningssystemen kan anses likvärdiga.

På grundval av dessa bevis har kommissionen kunnat fastställa graden av överensstämmelse mellan kraven i det berörda miljöledningssystemet och motsvarande krav i Emas-förordningen, vilket beskrivs i detta dokument.

Förklarande tabell ELH – begrepp

ELH-begrepp (SV)

ELH-begrepp (NO)

Begreppsdefinition av ELH

Stiftelsen Eco-Lighthouse (Eco-Lighthouse/ELH)

Stiftelsen Miljøfyrtårn (Miljøfyrtårn)

Den juridiska person som administrerar, övervakar och utvecklar Eco-Lighthouse certifieringssystem.

Eco-Lighthouse miljöredovisning

Miljøkartlegging

Webbaserad rapportering som skapas utifrån en förteckning över kriterier som har utarbetats av en konsult. Företaget dokumenterar att kriterierna uppfylls. Kontrollanten godkänner slutligen miljöredovisningen och bekräftar därmed att Eco-Lighthouse kriterier är uppfyllda.

Allmänna branschkriterier

Felles kriterier

Kriterier som gäller för alla företag som vill certifieras av Eco-Lighthouse. Företaget ska också ange om de äger eller hyr sina lokaler och avgöra vilka kriterier som är tillämpliga när det t.ex. gäller energi, avfallshantering osv. De allmänna branschkriterierna avser de viktigaste miljöaspekter som är gemensamma för alla företag.

Branschspecifika kriterier

Bransjespesifikke kriterier

Kriterier som gäller för alla företag inom särskilda branscher som vill certifieras av Eco-Lighthouse. De branschspecifika kriterierna avser de viktigaste miljöaspekterna i den berörda branschen.

Miljöansvarig

Miljøfyrtårnansvarlig

Den person i företaget som ledningen har utsett som ansvarig för genomförandet av Eco-Lighthouse-kriterierna.

Årlig klimat- och miljörapport

Årlig klima- og miljørapport

Företaget ska senast den 1 april varje år lämna in en rapport via Eco-Lighthouse webbportal. Indikatorer: några är generella, andra genereras utifrån de valda kriterierna. Handlingsplanen rapporteras också här. Den årliga klimat- och miljörapporten måste göras allmänt tillgänglig.

Handlingsplan/miljöprogram

Handlingsplan

Företagets handlingsplan för varje miljötema inför det kommande året. Handlingsplanen ska också dokumenteras i den årliga klimat- och miljörapporten. Ansvarsområden och tidsfrister kan dokumenteras i miljöredovisningen (miljøkartlegging) eller internt i företagets eget system.

Ledningens årliga genomgång

Ledelsens gjennomgang

Högre chefer och mellanchefer träffas varje år för att granska och utvärdera arbetsmiljösystemet, kvalitetssäkringssystemet, genomförandet av Eco-Lighthouse-systemet och andra frågor som är aktuella för företaget.

Miljöledningsgrupp

Miljøgruppe

Den arbetsgrupp som har utsetts för att bistå den miljöansvarige i genomförandet av Eco-Lighthouse-systemet. Den arbetsmiljöansvarige och andra berörda parter kan ingå i gruppen.

Eco-Lighthouse webbportal

Miljøfyrtårnportalen

Den webbaserade portal där dokumentation om företag, kommuner, konsulter och kontrollanter underhålls. Portalen innehåller all dokumentation om överensstämmelse med kriterier och certifiering.

Företagsspecifika indikatorer

Virksomhetsspesifikke sjekkpunkter

Anpassade indikatorer som har utformats på företagets begäran och som ingår i den årliga klimat- och miljörapporten. Betald tjänst.

Intern konsult

Internkonsulent

Anställd i ett företag som arbetar för att företaget ska certifieras av Eco-Lighthouse. Den anställda genomgår en utbildning som Eco-Lighthouse-konsult och blir därmed kvalificerad att vägleda företaget mot certifiering, vilket betyder att företaget inte behöver anlita en extern Eco-Lighthouse-konsult för den första certifieringen.

Checklista för arbetsmiljö

HMS sjekkliste

Företagets interna checklista för den årliga arbetsmiljögranskningen. Bland de viktigaste punkterna ingår uppdatering av lagstadgade krav, intern utbildning av anställda och ledning, miljöpolicy, mål och resultat i den årliga klimat- och miljörapporten, hantering av bristande regelefterlevnad.

Miljöpolicy

Miljøpolicy

Avsikter och riktlinjer för miljöprestanda, enligt företagets högsta ledning.

Miljöaspekt

Miljøaspekt

Delar i företagets verksamhet, produkter eller tjänster som kan påverka miljön.

Direkt miljöaspekt

Direkte miljøaspekt

Delar i företagets verksamhet, produkter eller tjänster som kan påverka miljön och som företaget har direkt kontroll över.

Indirekt miljöaspekt

Indirekte miljøaspekt

Delar i företagets verksamhet, produkter eller tjänster som kan påverka miljön och som företaget inte har direkt kontroll över, men som företaget kan påverka.

Miljömål

Miljømål

Miljömål som ska uppnås under det kommande året och som dokumenteras i den årliga klimat- och miljörapporten.

Miljöledningssystem

Miljøledelsessystem

Integrerat ledningssystem som kartlägger företagets miljöpåverkan och innehåller en uppsättning miljökriterier för att hantera denna påverkan. Miljöledningssystemet ska vara anpassat efter företagets verksamhet, innehålla tydliga mål, handlingsplaner med konkreta åtgärder som ska vidtas, och det ska garantera ständig förbättring.

Väsentlig ändring

Stor endring

Alla förändringar i företagets verksamhet (inklusive i dess produkter och tjänster), placering, organisation eller administration som har en betydande inverkan på företagets miljöledningssystem eller miljöaspekter.

Icke-efterlevnad

Avvik

Bristande efterlevnad av lagstadgade krav eller Eco-Lighthouse-kriterier, eller bådadera, om det lagstadgade kravet också är ett Eco-Lighthouse-kriterium. De viktigaste lagstadgade miljökraven är även Eco-Lighthouse-kriterier. Om ett Eco-Lighthouse-kriterium inte är uppfyllt kan företaget inte certifieras.

Metod som används för att granska hänvisningarna i det erkända miljöledningssystemet

Syftet med detta dokument är att beskriva kraven i Eco-Lighthouse miljöledningssystem och bedöma huruvida dessa krav uppfyller motsvarande krav i Emas-förordningen. Bedömningen har två huvudsakliga mål:

1.

Underlätta övergången till Emas för en organisation som har infört ett annat miljöledningssystem och vill gå över till Emas.

2.

Underlätta jämförelse mellan Eco-Lighthouse-kraven och Emas-kraven.

Inför denna bedömning gjorde kommissionen en gapanalys mellan kraven i de båda systemen. Efter denna analys har berörda krav delats in i grupper av viktiga krav som motsvarar olika delar i miljöledningssystemet. Därefter har dessa delars överensstämmelse med motsvarande krav i Emas-förordningen bedömts.

Följande delar i miljöledningssystemet kommer att analyseras i denna rapport:

1.

Högsta ledningens åtaganden och engagemang.

2.

Införande av en miljöutredning – preliminär analys.

3.

Införande av en miljöpolicy.

4.

Säkerställa regelefterlevnad.

5.

Fastställda mål och miljöprogram för att säkerställa ständig förbättring.

6.

Organisatorisk struktur, utbildning och de anställdas delaktighet.

7.

Dokumentationskrav.

8.

Verksamhetsstyrning.

9.

Beredskap och agerande vid nödlägen.

10.

Kontroll, internrevision och korrigerande åtgärder.

11.

Kommunikation (intern och extern).

12.

Ledningens genomgång.

Dessutom innehåller denna rapport en bedömning av de ackrediterings- eller licensieringskrav som tillåter en kvalificerad revisor från tredje part att kontrollera systemen.

För var och en av dessa delar innehåller den följande bedömningen en närmare beskrivning av i vilken omfattning Eco-Lighthouse-kraven överensstämmer med motsvarande Emas-krav. För att bedöma överensstämmelsen har kommissionen beaktat i vilken grad Eco-Lighthouse-kraven uppnår målen för motsvarande Emas-krav med samma tillförlitlighet och trovärdighet (4).

I vissa avseenden motsvarar hela eller delar av Eco-Lighthouse Emas-kraven till viss del, men inte fullt ut. För att ge en nyanserad bedömning placeras dessa delar i gruppen ”uppfyller delvis Emas-kraven”, tillsammans med förklaringar som kan vara till hjälp för Eco-Lighthouse-certifierade organisationer som är intresserade av att närma sig Emas.

Efter bedömningen kan de olika delarna grupperas i tre kategorier:

Uppfyller inte Emas-kraven.

Uppfyller delvis Emas-kraven.

Uppfyller Emas-kraven.

De delar som har erkänts uppfylla motsvarande Emas-krav (den tredje kategorin) ska betraktas som likvärdiga.

Beskrivning av Eco-Lighthouse

Certifieringssystemet Eco-Lighthouse är det mest använda miljöledningssystemet i Norge, med 5 000 giltiga certifikat som har utfärdats till små, medelstora och stora organisationer (Eco-Lighthouse riktar sig inte till företag med komplexa miljöutmaningar (5)). Genom åtgärder som är enkla att genomföra, konkreta, relevanta och lönsamma (i vid mening: lokalt, regionalt, globalt) kan företagen förbättra sin miljöprestanda, kontrollera sin miljöpåverkan och visa sitt engagemang för att ta sitt samhällsansvar.

Eco-Lighthouse certifieringssystem integrerar miljöledning för både interna och externa miljöaspekter i den rättsliga ram som utgörs av de norska förordningarna om systematiska arbetsmiljöåtgärder i företag.

Ett företag som vill bli Eco-Lighthouse-certifierat måste göra följande:

Före certifiering

1.

Anlita en kvalificerad Eco-Lighthouse-konsult som är utbildad, godkänd och övervakad av Eco-Lighthouse för att göra följande:

a)

Göra en miljöutredning (miljøanalyse) av företaget. Med utgångspunkt i den preliminära analysen väljer konsulten de branschspecifika kriterier (bransjespesifikke kriterier) som är relevanta för företaget utöver de allmänna branschkriterier (6) som ska tillämpas på alla organisationer.

b)

Ta fram och hjälpa till med att fylla i miljöredovisningen (7) (miljøkartlegging) i Eco-Lighthouse webbportal.

c)

Använda det webbaserade verktyget (miljøkartlegging) för att styra och dokumentera uppfyllandet av de berörda kriterierna.

d)

Utbilda den person som är miljöansvarig internt (miljøfyrtårnansvarlig) och som organisationen har utsett i att använda Eco-Lighthouse webbportal, inklusive miljöredovisningen.

e)

Utbilda den interna miljöansvarige i att fylla i den första utgåvan av den årliga klimat- och miljörapporten, som varje år ska innehålla en rapport (efter certifieringen) om hela det föregående kalenderåret.

f)

Styra processen för att uppfylla kriterierna.

2.

Organisationen ska via den webbaserade självrapporteringen i miljöredovisningen bekräfta att den uppfyller en uppsättning allmänna och branschspecifika kriterier innan certifieringsprocessen är avslutad. Alla allmänna och branschspecifika kriterier måste vara uppfyllda för att certifieringen ska utfärdas. Denna ”preliminära” självrapportering ska dokumenteras skriftligt och dokumentationen ska sparas som en del av miljöredovisningen.

3.

Eco-Lighthouse utvecklar allmänna och branschspecifika kriterier i samarbete med berörda statliga organ, forskare, intresseorganisationer, kunder och erfarna konsulter och kontrollanter för att identifiera och hantera relevanta miljöaspekter och effektiva åtgärder i den berörda branschen. Kriterierna ses över regelbundet.

4.

Kriterierna utgör ryggraden i ledningssystemet och är en garanti för att systemet fungerar tillfredsställande. Rapporteringen av att alla kriterier är uppfyllda görs via miljöredovisningen i Eco-Lighthouse webbportal.

5.

Klimat- och miljörapporten (klima- og miljørapport) ska fyllas i och lämnas in i Eco-Lighthouse webbportal. Rapporten omfattar såväl allmänna indikatorer och parametrar som är giltiga för alla branscher som specifika indikatorer som beror på valet av relevanta kriterier.

6.

När företaget anser att samtliga kriterier är uppfyllda och den första klimat- och miljörapporten har lämnats in görs certifieringen av en kontrollant. Kontrollanten får tillgång till relevanta uppgifter i webbportalen innan han eller hon besöker anläggningen och gör intervjuer och kontroller. Kontrollanten utfärdar certifikat för den kommuns räkning där företaget är baserat, men utbildas, godkänns (licensieras) och övervakas av Eco-Lighthouse centrala förvaltning, vilket även innefattar (från och med 2017) observation på plats. Bristande efterlevnad av kriterierna och avhjälpta brister ska dokumenteras i miljöredovisningen.

7.

Det dokumenterade resultatet av hela processen kontrolleras av stiftelsen Eco-Lighthouse och ett certifikat utfärdas. Det är först i detta steg som en motsvarande certifieringsrapport och en skrivelse om erkännande utfärdas.

Efter certifieringen

Efter certifieringen ska klimat- och miljörapporten lämnas in senast den 1 april varje år. Den ska innehålla uppgifter om status för ett antal parametrar, huruvida tidigare fastställda miljömål har uppnåtts och en detaljerad beskrivning av framtida mål. Denna årsrapport ska utarbetas av den miljöansvarige.

Omcertifieringen görs vart tredje år.

Processen ser likadan ut, men det ställs inga krav på att en konsult anlitas för omcertifieringen. I stället är det den miljöansvarige (miljøfyrtårnansvarlig) som ansvarar för att anordna omcertifieringen, kontrollera att kriterierna fortfarande uppfylls, fylla i miljöredovisningen och ge kontrollanten tillgång till företagets dokumentation via Eco-Lighthouse webbportal. Den nya miljöredovisningen och motsvarande dokumentation utgör tillsammans med de föregående årens inlämnade klimat- och miljörapporter de huvudsakliga bevis som lämnas in före omcertifieringen. Vid mötet med företaget gör kontrollanten sedan intervjuer, stickprovskontroller och en inspektion av lokalerna, precis som vid den första certifieringen.

Anmärkning:

Mer än 300 norska kommuner av ungefär 430 är betalande medlemmar i Eco-Lighthouse certifieringssystem. Medlemskapet gör bl.a. Eco-Lighthouse-certifieringen lättare för lokala företag genom att företagen får tillgång till en lokal kontrollant. Kommunerna förväntas också arbeta för att få sina egna företag certifierade.

Kontrollanter som deltar i certifieringsfasen kan vara anställda av kommunen/länsstyrelsen eller av ett privat företag och utbildas, godkänns och övervakas av stiftelsen Eco-Lighthouse. Det är viktigt att påpeka att i Eco-Lighthouse-systemet är kommunen det certifierande organet, eftersom kontrollanterna (som har licens från Eco-Lighthouse) agerar för kommunens räkning, inte för Eco-Lighthouse-administrationen.

Stiftelsen Eco-Lighthouse är certifierad enligt standarden ISO-9001:2015 sedan maj 2016.

Internrevision/Ledningens genomgån Övergripande schema för genomförandet av Eco-Lighthouse och Emas

Image

DEL 1

Den högsta ledningens åtaganden och engagemang

Motsvarande Emas-krav

1.

Den högsta ledningens delaktighet och åtagande. Enligt Emas ska den högsta ledningen fastställa organisationens miljöpolicy (1.1) och ansvarar för att miljöledningssystemet genomförs korrekt (1.2), bl.a. genom att utse en företrädare med ansvar för miljön (1.3). Rättslig grund: Artikel 2.1 och punkt A.2 och A.4 i bilaga II.

2.

Ledningen bör granska framstegen regelbundet och ta itu med de problem som upptäcks. Ledningen behöver delta regelbundet i möten och initiativ inom ramen för miljöledningssystemet (punkt A.6 i bilaga II).

Bedömning av motsvarande Eco-Lighthouse-krav

1.   Den högsta ledningens delaktighet och åtagande

1.1   Definition av organisationens miljöpolicy:

Enligt allmänt branschkriterium 1945 (8) ska organisationen upprätta en miljöpolicy. Beslutet om att delta i systemet och åtagandet om att uppfylla de olika kriterierna ska också godkännas av ledningen.

1.2   Ansvar för att miljöledningssystemet genomförs korrekt:

I allmänt branschkriterium 6 anges att ledningen måste göra en årlig genomgång av systemet för arbetsmiljö och av Eco-Lighthouse-rutinerna för att bedöma om de har fungerat som det var avsett.

Genom att underteckna Eco-Lighthouse villkor och protokollen från ledningens årliga genomgång tar den högsta ledningen ansvar för att ledningssystemet genomförs korrekt och att den årliga klimat- och miljörapporten (klima- og miljørapport) är korrekt.

1.3   Utnämning av miljöansvarig företrädare:

En anställd utnämns som miljöansvarig (miljøfyrtårnansvarlig). Detta behöver inte vara ett heltidsuppdrag, beroende på organisationens storlek. Den miljöansvarige kan utbildas av konsulten vid den första certifieringen eller av den föregående miljöansvarige. I större organisationer deltar den miljöansvarige ibland i Eco-Lighthouse konsultkurs (och blir därmed kvalificerad som internkonsult [internkonsulent]). Hans eller hennes uppgifter anges i krav 6 (Organisatorisk struktur, utbildning och de anställdas delaktighet).

2.   Ledningen granskar regelbundet framstegen och tar itu med de problem som upptäcks

Detta görs genom ledningens årliga genomgång (9) (ledelsens gjennomgang), som ledningen undertecknar (ledningen undertecknar protokollet från sitt årliga möte om genomgången). En rapport om bristande regelefterlevnad (i fråga om lagstadgade krav och/eller Eco-Lighthouse-kriterier) och den eller de årliga klimat- och miljörapporterna presenteras. Rapporterna ska innehålla en bedömning av miljöprestandan och miljömål för det kommande året. Certifierings- eller omcertifieringsrapporten kan presenteras, framför allt om det har förekommit bristande regelefterlevnad.

Den årliga bedömningen är alltså en kvalitetskontroll (kundnöjdhet, organisation, konstaterade brister i regelefterlevnaden), men handlar också om huruvida miljömålen har uppfyllts och handlingsplanen har genomförts, och innefattar en granskning av framstegen inom områden som avfall, energianvändning och miljöindikatorer som är relevanta för branschen. Om det förekommer bristande regelefterlevnad som berör Eco-Lighthouse och/eller den yttre miljön ska dessa hanteras här (avhjälpa bristerna direkt eller – om detta inte är möjligt – föra in dem i handlingsplanen för det kommande året).

I allmänt branschkriterium 1950 anges följande: ”Företaget ska införa rutiner för att rapportera och hantera bristande regelefterlevnad.” (10) Det innebär att ledningen har ansvar för miljöpolicyn, målen och resultaten inom Eco-Lighthouse genom att (minst) varje år uppdatera och bekräfta åtagandet.

Det kompletterande arbetsmiljösystem som krävs enligt norsk lag (11) säkerställer dessutom att de miljömål som anges i handlingsplanen och redovisas i avsnittet om resultat i den årliga klimat- och miljörapporten uppfylls och att instruktionerna följs.

Kommissionens slutsats

Den högsta chefen undertecknar villkoren och åtagandena för Eco-Lighthouse i det inledande skedet i certifieringsprocessen (via webbportalen). Enligt allmänt branschkriterium 1945 ska organisationer upprätta en miljöpolicy. Ledningen ska göra en detaljerad och upprepad granskning (genom kontroller) vid olika tidpunkter under året och vid den årliga genomgången. Den organisation som genomför Eco-Lighthouse måste också utse en miljöansvarig som rapporterar till den högsta ledningen (eller ingår i den högsta ledningen) och samordnar med personalen i frågor som berör Eco-Lighthouse.

Mot bakgrund av detta erkänner kommissionen att den del av Eco-Lighthouse som avser den högsta ledningens åtagande och engagemang uppfyller motsvarande Emas-krav och därför kan betraktas som likvärdig.

DEL 2

Införande av en miljöutredning (preliminär analys)

Motsvarande Emas-krav

Före registreringen ska organisationen göra en miljöutredning som baseras på bilaga I till förordningen (artikel 4.1 a, bilaga I, punkt A.3.1 i bilaga II).

Den preliminära analysen ska omfatta följande områden:

1.

Identifiering av tillämpliga lagstadgade miljökrav.

2.

Identifiering av alla direkta och indirekta miljöaspekter som har en betydande miljöpåverkan, med angivande av egenskap och kvantitet beroende på vad som passar, och upprättande av ett register över dem som identifierats som betydande.

3.

Beskrivning av kriterierna för att bedöma miljöpåverkans betydelse.

4.

Undersökning av alla befintliga miljöledningsrutiner och miljöledningsförfaranden.

5.

Utvärdering av återkoppling från undersökningar av tidigare tillbud.

Denna utredning ska kontrolleras av den externa kontrollanten.

Bedömning av motsvarande Eco-Lighthouse-krav

Allmän bedömning: Eco-Lighthouse preliminära analys, den s.k. miljöredovisningen (miljøkartlegging) görs av en konsult (som utbildas, godkänns och övervakas av Eco-Lighthouse). Efter att ha analyserat organisationen väljer konsulten de relevanta kriterier som organisationen ska uppfylla för att certifieras av Eco-Lighthouse. Baserat på denna analys tas den webbaserade miljöredovisningen (miljøkartlegging) fram i form av en förteckning över kriterier som ska vara uppfyllda, vilket hjälper organisationen att identifiera de områden där det krävs förbättringar. I nästa steg kan organisationen använda det interaktiva förfarandet i Eco-Lighthouse webbportal (miljøfyrtårnportalen) för att registrera framstegen och övervaka hela förteckningen över tillämpliga kriterier som ska vara uppfyllda.

Eco-Lighthouse innehåller allmänna branschkriterier som är tillämpliga på alla sektorer och specifika kriterier som har fastställts på förhand för vissa branscher och som rör 14 olika industrisektorer (12).

1.   Identifiering av tillämpliga lagstadgade miljökrav

De allmänna branschkriterierna omfattar också en kontroll av att de lagstadgade kraven är uppfyllda. Kontrollen görs i enlighet med allmänt branschkriterium 1944: Företaget ska se till att det finns tillgång  (13) till en aktuell översikt över gällande lagar och förordningar som rör arbetsmiljö. Tillgång och registrering underlättas av den norska regeringens webbplats Regelhjelp (14) där företag anger sitt organisationsnummer och skapar en förteckning över tillämpliga lagstadgade krav för företaget, inklusive miljörelaterade sådana. I de allmänna och branschspecifika kriterierna markeras alla kriterier som följer av lagar och förordningar tydligt med symbolen § för att visa att avsikten med kriteriet är att uppfylla de lagstadgade kraven.

2.   Identifiering av alla direkta och indirekta miljöaspekter som har en betydande miljöpåverkan, med angivande av egenskap och kvantitet beroende på vad som passar, och upprättande av ett register över dem som identifierats som betydande

Under processen med att utveckla branschkriterier identifieras och förtecknas miljöaspekter som är centrala för de branscher som omfattas av Eco-Lighthouse specifika kriterier. De på förhand definierade kriterierna utvecklas i samarbete med berörda branschorganisationer, intressegrupper, regeringen, vetenskapsmän/forskare och de viktigaste kunderna. Avsikten med att interaktivt ta fram en på förhand definierad uppsättning kriterier är att hjälpa och vägleda organisationerna så att de enkelt ska kunna sätta ett tydligt riktmärke. Denna process är uppenbart en av de största skillnaderna mellan Emas och Eco-Lighthouse metoder. Den förra är inriktad på att identifiera miljöaspekter på organisationsnivå medan den senare identifierar dem på branschnivå.

Av 31 allmänna branschkriterier hävdar Eco-Lighthouse att 35 % är systemkriterier, 4 % avser arbetsmiljö och 52 % rör den yttre miljön (15). Av de branschspecifika kriterierna hävdar Eco-Lighthouse att i genomsnitt 10 % är systemkriterier, 20 % avser arbetsmiljö och 70 % rör den yttre miljön (16). En närmare titt på de kriterier som har flest certifikat (och som alltså revideras och uppdateras oftast), t.ex. hotell eller livsmedelsbutiker (17), bekräftar att dessa kriterier omfattar ett antal relevanta viktiga miljöaspekter.

I de allmänna branschkriterierna ingår också kriterium 1963 ”Övriga miljöaspekter”, som innebär att företaget är skyldigt att utvärdera och ta itu med alla relevanta miljöaspekter som inte omfattas av de allmänna och branschspecifika kriterierna: ”Företag ska identifiera andra betydande miljöaspekter på företaget och överväga att vidta eventuella nödvändiga åtgärder och/eller ta med dem i den årliga klimat- och miljörapporten och/eller övervaka dem via handlingsplanen.” Eco-Lighthouse definierar dock inte hur detta kriterium ska tillämpas, t.ex. vilken typ av aspekter som ska beaktas (direkta eller indirekta) och hur det ska bedömas om deras effekter är betydande (18). Det är inte heller uppenbart hur man ska kunna avgöra om kriteriet är uppfyllt, bl.a. när det gäller på vilken grund Eco-Lighthouse-kontrollanten ska kunna säkerställa att alla betydande miljöaspekter har identifierats (19).

De kriterier som anges i förteckningen kontrolleras vid kontrollen/certifieringen och samtliga måste vara uppfyllda innan (20) certifieringen utfärdas. Kriterierna ska kontrolleras på nytt vart tredje år för omcertifiering.

3.   Beskrivning av kriterierna för att bedöma miljöpåverkans betydelse

Bedömningen av miljökonsekvenserna görs genom processen med att utveckla branschkriterier. Bedömningen utförs alltså inte av organisationen utan behandlas på sektorsnivå av de berörda parterna inom branschen. I Emas bilaga I.3 finns en särskild vägledning och kriterier för att bedöma miljökonsekvensers betydelse på organisationsnivå. Eco-Lighthouse ger inte någon sådan vägledning, utan bedömningen görs på branschnivå av rådgivande expertgrupper.

4 och 5.   Ledningens befintliga metod och förfarande samt utvärdering av återkoppling från undersökningar av tidigare tillbud

Ledningens befintliga metod och förfarande granskas och utvärderas genom branschkriterierna. Före certifiering utarbetas en första årlig klimat- och miljörapport som bifogas miljöredovisningen. Rapporten innehåller positiva och negativa punkter i organisationens miljöledning. Den tar uttryckligen hänsyn till ”Tagna initiativ” (Gjennomførte tiltak) för att korrigera situationer som inte var/är optimala. En handlingsplan (handlingsplan med mål) upprättas baserat på denna information.

Kommissionens slutsats

Eco-Lighthouse preliminära analys utgår från ett antal kriterier baserade på miljöaspekter som har identifierats på sektorsnivå. Eco-Lighthouse kan ta tillfredsställande hänsyn till en betydande andel av organisationens potentiella miljöaspekter när branschkriterierna definieras. Därefter tar organisationen upp dessa aspekter i sin bedömning av huruvida de fastställda kriterierna är uppfyllda under arbetet inför certifieringen.

Enligt Emas krävs en individuellt anpassad analys av organisationens särskilda direkta och indirekta miljöaspekter. Det krävs också att organisationen fastställer kriterier för att avgöra vikten av de konsekvenser som är relaterade till de identifierade kriterierna i organisationens specifika fall. Syftet med denna organisationsinriktade strategi är att identifiera aspekter som är viktiga i organisationens specifika fall, inte för sektorn som helhet. Denna individuella anpassning är en av de viktigaste skillnaderna mellan de båda systemen.

Eco-Lighthouse allmänna kriterium 1963, där det krävs att även relevanta ”Övriga miljöaspekter” ska beaktas, kan användas för att bredda analysen och få en mer specifik genomgång. I vägledningen för kriteriet rekommenderar Eco-Lighthouse att detta kan tillämpas i samband med riskanalysen. Eco-Lighthouse definierar dock inte hur vikten av dessa ytterligare aspekter ska bedömas.

Båda strategierna är värdefulla och har både för- och nackdelar, men de metoder som tillämpas skiljer sig väsentligt från varandra. Ett liknande mål eftersträvas – att identifiera viktiga miljöaspekter – men med olika metoder. Eco-Lighthouse är fokuserat på att identifiera miljöaspekter på sektorsnivå, medan Emas strävar efter att identifiera organisationsspecifika viktiga aspekter. Därför kan de båda strategierna inte anses vara likvärdiga (21).

Därför anser kommissionen att Eco-Lighthouse införande av en miljöutredning delvis stämmer överens med motsvarande Emas-krav.

Möjliga åtgärder för att överbrygga avståndet till Emas

Även om denna del av Eco-Lighthouse inte kan anses vara likvärdig med Emas visar analysen att det råder stor samstämmighet med många motsvarande Emas-krav. För att uppfylla samtliga motsvarande krav behöver följande kompletterande delar genomföras:

En övergång från en strategi som baseras på riskanalys till en strategi och en metod som baseras på Emas, bilaga I, med målsättningen att även identifiera viktiga miljöaspekter som inte omfattas av branschkriterierna.

För detta syfte ska det allmänna branschkriteriet 1 963 tillämpas baserat på bestämmelsen om Emas miljöutredning.

Eco-Lighthouse-kontrollanten ska, med lämplig metod, se till att eventuella ytterligare miljöaspekter, indikatorer och lagstadgade krav har identifierats och behandlats.

DEL 3

Införandet av en miljöpolicy

Motsvarande Emas-krav

Den högsta ledningen ska fastställa organisationens miljöpolicy. Policyn ska omfatta de olika delar som anges i bilaga II till Emas-förordningen (artikel 4.1 b och punkt A.2 i bilaga II).

Bedömning av motsvarande Eco-Lighthouse-krav

Eco-Lighthouse omfattar ett formellt krav på att det ska fastställas mål, i enlighet med kriterium 1945 (”Företaget ska fastställa en miljöpolicy (22) och mål för hälsa, miljö och säkerhet. Dessa måste dokumenteras i miljöledningssystemet eller i handlingsplanen för Eco-Lighthouse årliga klimat- och miljörapport”). Miljöpolicyn och de specifika miljömålen hanteras först genom att kriterierna fastställs före certifieringen och anges i miljöredovisningen (miljøkartlegging). I ett andra steg kontrolleras miljöprestandan i förhållande till utvalda indikatorer i den årliga klimat- och miljörapporten, som även innehåller en handlingsplan för ständig förbättring.

Kommissionens slutsats

Enligt det nyligen ändrade kriteriet 1 945 ska företaget fastställa en miljöpolicy. Miljöpolicyn fördjupas och blir lättare att genomföra genom kombinationen av miljöredovisning, fastställda kriterier och en årlig klimat- och miljörapport samt kontroll av indikatorer och fastställda mål.

Viljan att bli certifierad av Eco-Lighthouse och underteckna Eco-Lighthouse villkor visar att man har för avsikt att stärka ledningen i fråga om miljöaspekterna och att ständigt förbättra sin miljöprestanda. I och med att den årliga klimat- och miljörapporten omfattar en handlingsplan blir den en drivkraft för ständig förbättring.

Den årliga klimat- och miljörapporten ska ratificeras av ledningen vid den årliga genomgången.

Mot bakgrund av detta erkänner kommissionen att den del av Eco-Lighthouse som avser införandet av en miljöpolicy uppfyller motsvarande Emas-krav och därför kan betraktas som likvärdig.

DEL 4

Säkerställa regelefterlevnad

Motsvarande Emas-krav

Enligt Emas ska organisationerna

1.

identifiera sina lagstadgade skyldigheter i fråga om miljön,

2.

vidta åtgärder för att dessa krav ska uppfyllas,

3.

fastställa lämpliga förfaranden för att fortlöpande uppfylla dessa krav,

4.

tillhandahålla faktaunderlag och dokument som styrker att organisationen uppfyller kraven.

(Artikel 4.1 b och 4.4, punkterna A.3.2, B.2, A.5.2 i bilaga II)

Bedömning av motsvarande Eco-Lighthouse-krav

1.

Före Eco-Lighthouse-certifieringen upprättar konsulten en förteckning över kriterier. Enligt allmänt branschkriterium 1944 (23) är företaget skyldigt att se till att kontrollanten (och hela företaget) har tillgång till en aktuell översikt över gällande lagar och förordningar som rör företaget.

Den norska statliga webbplatsen Regelhjelp  (24) gör det lättare att uppfylla detta villkor. Där kan företaget få en förteckning över all gällande lagstiftning baserat på sitt unika organisationsnummer. De regler och förordningar som är mest relevanta för branschen ingår i de allmänna och branschspecifika kriterierna (markeras med §) som måste vara uppfyllda för certifiering och omcertifiering. Ledningens årliga genomgång säkerställer att översikten uppdateras varje år (genom den årliga arbetsmiljögenomgången).

Förteckningen över kriterier innehåller också kriterier som rör särskilda lagstadgade krav som organisationen måste uppfylla.

Exempel:

Lagstadgat allmänt kriterium 42: ”farligt avfall (och […]) måste förvaras säkert och levereras till en […] anläggning i enlighet med förordningarna om återvinning av avfall”.

Lagstadgat specifikt kriterium 311: ”Prover ska tas från avloppsvattnet och analyseras i enlighet med lokala föreskrifter och förordningen om föroreningar 15A-3 och 4.” (Översättning)

2.

Företaget gör en egenkontroll före certifieringen och bekräftar att det uppfyller alla dessa kriterier. Därefter kontrolleras kriterierna på nytt av den oberoende kontrollanten från tredje part under certifieringen. Innan en Eco-Lighthouse-certifiering utfärdas gör Eco-Lighthouse-stiftelsen ytterligare en kontroll av det arbete som har utförts av konsulten, företaget och kontrollanten och godkänner det. Kontrollen upprepas vid omcertifieringen vart tredje år. Alla kriterier måste vara uppfyllda innan certifieringen kan göras, inklusive de allmänna och specifika kriterier som införlivas direkt från norsk lag i Eco-Lighthouse-kriterierna (märkta med §). Bristande efterlevnad av ett lagstadgat kriterium som inte är ett Eco-Lighthouse-kriterium hanteras i allmänt branschkriterium 1950, där företagen åläggs att införa rutiner för att rapportera och hantera sådana brister. Baserat på detta kriterium kan företaget certifieras om de visar att de har ett system för att hantera bristande regelefterlevnad. Kontrollanten kontrollerar att Eco-Lighthouse kriterier är uppfyllda och bekräftar att företaget har infört ett förfarande för att avhjälpa bristande efterlevnad av övergripande lagstadgade bestämmelser.

Till skillnad från Emas kräver Eco-Lighthouse inte att organisationerna ska ge kontrollanten bevis för att miljölagstiftningen (25) följs fullt ut, utöver de specifika (lagstadgade) kriterierna.